From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09185 [old locus tag: NWMN_1635 ]
  • pan locus tag?: SAUPAN004409000
  • symbol: NWMN_RS09185
  • pan gene symbol?:
  • synonym:
  • product: tRNA-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09185 [old locus tag: NWMN_1635 ]
  • symbol: NWMN_RS09185
  • product: tRNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1823804..1824400
  • length: 597
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1823804..1824400) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATTTATTTTACAATCCTAAATATGTAGGAGATGTCGCATTTTTACAAATTGAACCA
    GTTGAAGGTGAATTAAACTACAATAAAAAAGGTAATGTTGTTGAAATTACTAATGAAGGT
    AATGTTGTAGGTTATAATATTTTTGAAATTTCAAAAGATATAACAATTGAAGAAAAAGGT
    CATATTAAATTAACTGATGAACTTGTAAATGTATTCCAAAAGCGTATTTCAGAAGCTGGT
    TTTGATTATAAATTAAATGCTGATCTATCACCGAAATTTGTAGTTGGCTACGTTGAAACT
    AAAGACAAACATCCTGATGCAGATAAATTAAGTGTACTAAATGTAAACGTTGGAAATGAC
    ACATTACAAATTGTATGTGGCGCGCCTAACGTTGAAGCTGGACAGAAAGTTGTTGTTGCT
    AAAGTAGGTGCAGTGATGCCTAGCGGTATGGTAATTAAAGATGCTGAATTACGTGGTGTT
    GCCTCAAGCGGTATGATTTGTTCAATGAAAGAATTGAATTTACCTAATGCACCTGAAGAA
    AAAGGTATTATGGTATTAAATGACAGCTATGAAATTGGACAAGCATTTTTTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    597

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09185 [old locus tag: NWMN_1635 ]
  • symbol: NWMN_RS09185
  • description: tRNA-binding protein
  • length: 198
  • theoretical pI: 4.4561
  • theoretical MW: 21689.7
  • GRAVY: -0.113636

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationphenylalanine--tRNA ligase, beta subunit (TIGR00472; EC 6.1.1.20; HMM-score: 145)
    Genetic information processingProtein synthesistRNA aminoacylationmethionine--tRNA ligase, beta subunit (TIGR00399; EC 6.1.1.10; HMM-score: 24.4)
  • TheSEED:
  • PFAM:
    OB (CL0021) tRNA_bind; Putative tRNA binding domain (PF01588; HMM-score: 84.3)
    no clan definedDUF4479; Domain of unknown function (DUF4479) (PF14794; HMM-score: 76.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS1242050S ribosomal protein L4  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 32
    • Cmax: 0.131
    • Cmax_pos: 24
    • Smax: 0.269
    • Smax_pos: 23
    • Smean: 0.138
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446971112 NCBI
  • RefSeq: WP_001048368 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKGHIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGNDTLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEEKGIMVLNDSYEIGQAFFE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09185 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]