From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • pan locus tag?: SAUPAN004526000
  • symbol: NWMN_RS09520
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • symbol: NWMN_RS09520
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 1889301..1889444
  • length: 144
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1889301..1889444) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGACAAGAGAAAGAAGATCATTTAGTTCAGAGTTTAAGTTACAAATGGTTAGATTATAT
    AAAAATGGTAAGCCTAGGAATGAAATTATACGCGAGTATGATTTCACACCTTCGACGTTT
    GTAAATGGCGGTTATAAAATGTAG
    60
    120
    144

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • symbol: NWMN_RS09520
  • description: transposase
  • length: 47
  • theoretical pI: 10.6298
  • theoretical MW: 5709.53
  • GRAVY: -0.974468

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_Tnp_1; Transposase (PF01527; HMM-score: 34.9)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.4)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 20.7)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 17.4)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.7)
    BrkDBD; Brinker DNA-binding domain (PF09607; HMM-score: 14.2)
    no clan definedDUF3734; Patatin phospholipase (PF12536; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.176
    • Ymax_pos: 11
    • Cmax: 0.102
    • Cmax_pos: 21
    • Smax: 0.44
    • Smax_pos: 3
    • Smean: 0.307
    • D: 0.227
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 486200335 NCBI
  • RefSeq: WP_001549059 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTRERRSFSSEFKLQMVRLYKNGKPRNEIIREYDFTPSTFVNGGYKM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS09520 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]