From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10200 [old locus tag: NWMN_1785 ]
  • pan locus tag?: SAUPAN001736000
  • symbol: NWMN_RS10200
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10200 [old locus tag: NWMN_1785 ]
  • symbol: NWMN_RS10200
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1999111..1999458
  • length: 348
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1999111..1999458) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAATATAGATGGATTAGACGCACTGTTAAACCAATTTCATGATATGAAAACCAACATT
    GATGATGATGTAGATGATATTTTACAGGAAAACGCCAAAGAATATGTAGTACGAGCTAAA
    TTGAAAGCTAGAGAAGTAATGAATAAGGGTTATTGGACTGGTAATTTATCACGCAATATC
    AGATATAAAAAAACTGGCGATTTGCAATACACTATCACATCGCATGCAGCTTATAGTGGT
    TTCTTAGAGTTTGGTACTCGATACATGGAGGCAGAACCTTTTATGTGGCCAGTATATGAG
    GTAATAAGAAAATCAACTGTAGAAGAATTGAAAGCGTTGTTTGAATAG
    60
    120
    180
    240
    300
    348

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10200 [old locus tag: NWMN_1785 ]
  • symbol: NWMN_RS10200
  • description: hypothetical protein
  • length: 115
  • theoretical pI: 4.9411
  • theoretical MW: 13465.2
  • GRAVY: -0.541739

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage protein, HK97 gp10 family (TIGR01725; HMM-score: 90.1)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesubiquitin-like protein Pup (TIGR03687; HMM-score: 15.1)
  • TheSEED:
  • PFAM:
    Phage_tail (CL0348) HK97-gp10_like; Bacteriophage HK97-gp10, putative tail-component (PF04883; HMM-score: 39.7)
    Histone (CL0012) TFIID_20kDa; Transcription initiation factor TFIID subunit A (PF03847; HMM-score: 14.2)
    no clan definedPup; Pup-like protein (PF05639; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.095
    • Ymax_pos: 70
    • Cmax: 0.104
    • Cmax_pos: 22
    • Smax: 0.105
    • Smax_pos: 66
    • Smean: 0.075
    • D: 0.087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446940559 NCBI
  • RefSeq: WP_001017815 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNIDGLDALLNQFHDMKTNIDDDVDDILQENAKEYVVRAKLKAREVMNKGYWTGNLSRNIRYKKTGDLQYTITSHAAYSGFLEFGTRYMEAEPFMWPVYEVIRKSTVEELKALFE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10200 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]