From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS12090 [old locus tag: NWMN_2088 ]
  • pan locus tag?: SAUPAN005580000
  • symbol: NWMN_RS12090
  • pan gene symbol?: amaP
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS12090 [old locus tag: NWMN_2088 ]
  • symbol: NWMN_RS12090
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2324652..2325188
  • length: 537
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2324652..2325188) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATCGTGGGGTTCCTG
    TTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTACTTCCTTCAATTT
    GAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTAATAGGTCTTATA
    TTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATACAAAGACTTCGAT
    GATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTCGATACGGTTGCA
    AAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAACAAAAAAAATAAA
    TCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAAGTTCAATCTTTA
    ACTGAAGCAATTCGTTCGGATATTAAAAAGAATGTAGAATATTTCACAGAAATGCCAGTA
    CGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGAGTGTTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS12090 [old locus tag: NWMN_2088 ]
  • symbol: NWMN_RS12090
  • description: hypothetical protein
  • length: 178
  • theoretical pI: 10.0687
  • theoretical MW: 20800.3
  • GRAVY: 0

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedAsp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 23.1)
    LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 15)
    TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 14.5)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 14.5)
    no clan definedDUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.3)
    Spore_III_AF; Stage III sporulation protein AF (Spore_III_AF) (PF09581; HMM-score: 14.3)
    COX1; Cytochrome C and Quinol oxidase polypeptide I (PF00115; HMM-score: 13.5)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 13.3)
    no clan definedYoqO; YoqO-like protein (PF14037; HMM-score: 12.8)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 12.1)
    no clan definedFtsH_ext; FtsH Extracellular (PF06480; HMM-score: 11.7)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 11.2)
    DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.8)
    DUF3951; Protein of unknown function (DUF3951) (PF13131; HMM-score: 7.1)
    Pox_EPC_I2-L1; Poxvirus entry protein complex L1 and I2 (PF12575; HMM-score: 6.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.169
    • Ymax_pos: 11
    • Cmax: 0.148
    • Cmax_pos: 31
    • Smax: 0.398
    • Smax_pos: 2
    • Smean: 0.265
    • D: 0.207
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446748563 NCBI
  • RefSeq: WP_000825819 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS12090 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]