From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13045 [old locus tag: NWMN_2266 ]
  • pan locus tag?: SAUPAN005873000
  • symbol: NWMN_RS13045
  • pan gene symbol?:
  • synonym:
  • product: DUF3021 domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13045 [old locus tag: NWMN_2266 ]
  • symbol: NWMN_RS13045
  • product: DUF3021 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2488467..2488922
  • length: 456
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2488467..2488922) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAAATTTGAAAAACTCATTATTTATTAGCTTAATCATTGGTTTGTCCCTTTCACTG
    TTCTTTAGTATGTTATTTGCAGACGGCAAATATTATCCACTGAACCCACAATCAACTATT
    GGCATATTGTATTATACGCATTTCACAGAAACTACCGTAATGTTGATTTCTATCATTTTA
    TGGTTACTCATAGGCGTCGTCTTTTTCCTTGGAGATTTTATCTTTAAATACACAGATTGG
    AGCATTACTAAAGCAACTATAATGCATTTCATAACAACGTATGTCGGATTCTTGCCTTTA
    GCAATGCTTGCCGGTTGGTTTCCACTAACAGTGCATTATCTAATCATATTCACAATTATC
    TTCATTGTGGTTTATGTATTAATTTGGATAATTCAATTCTTTAAAAACAAGAACTACGTA
    GACACTATTAACAAGCAACTGAAACAATTAAAATGA
    60
    120
    180
    240
    300
    360
    420
    456

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13045 [old locus tag: NWMN_2266 ]
  • symbol: NWMN_RS13045
  • description: DUF3021 domain-containing protein
  • length: 151
  • theoretical pI: 9.82185
  • theoretical MW: 17676.2
  • GRAVY: 0.93245

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesistype VI secretion protein IcmF (TIGR03348; HMM-score: 9)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanstage V sporulation protein D (TIGR02214; HMM-score: 7.3)
    Cellular processesCellular processesSporulation and germinationstage V sporulation protein D (TIGR02214; HMM-score: 7.3)
  • TheSEED:
  • PFAM:
    no clan definedDUF3021; Protein of unknown function (DUF3021) (PF11457; HMM-score: 119.1)
    DUF4271; Domain of unknown function (DUF4271) (PF14093; HMM-score: 16.6)
    DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.1)
    AsmA-like (CL0401) AsmA; AsmA family (PF05170; HMM-score: 10.8)
    no clan definedHolin_SPP1; SPP1 phage holin (PF04688; HMM-score: 10.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.339
    • Ymax_pos: 28
    • Cmax: 0.437
    • Cmax_pos: 28
    • Smax: 0.512
    • Smax_pos: 7
    • Smean: 0.354
    • D: 0.345
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 446715848 NCBI
  • RefSeq: WP_000793169 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFTETTVMLISIILWLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTIIFIVVYVLIWIIQFFKNKNYVDTINKQLKQLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13045 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]