From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13660 [old locus tag: NWMN_2371 ]
  • pan locus tag?: SAUPAN006038000
  • symbol: NWMN_RS13660
  • pan gene symbol?:
  • synonym:
  • product: carboxymuconolactone decarboxylase family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS13660 [old locus tag: NWMN_2371 ]
  • symbol: NWMN_RS13660
  • product: carboxymuconolactone decarboxylase family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2609569..2609991
  • length: 423
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2609569..2609991) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCCGTATAATTACAAGAAACAAAATGGAGAGTTAATGTCTGTAATGAGCCAAGGTGAA
    AAGTTTATTCATCAATCACCCGTTAATGATGAACTTAGTGCATTGATTAAGTTATTAATT
    TCTAAAATTAACGGTTGTCATTATTGTGTTGATATCCATAAAAAAGAATTAAAGGAATTG
    GGTGTAACACAAATGAAAATTGATGAAGTCTTGAGTTTTAGACATTTAGATTTATTTACT
    GATCAAGAAAAAGTGACGCTTGAATTTGCAGAAATGTTAAATTCAATCAAAGACTTTAAG
    AAGTTTGAAATTATTGACCGGCTAAAATCATTTTATGATGAAGAACAAATTATTGATCTT
    GTCTTTGTTGTAAACCAAATTAACGGTTGGAACAGATTAAATATTATTAGTGATAGACTA
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS13660 [old locus tag: NWMN_2371 ]
  • symbol: NWMN_RS13660
  • description: carboxymuconolactone decarboxylase family protein
  • length: 140
  • theoretical pI: 5.65611
  • theoretical MW: 16484
  • GRAVY: -0.263571

Function[edit source | edit]

  • reaction:
    EC 1.11.1.15?  ExPASy
    Peroxiredoxin2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH
  • TIGRFAM:
    uncharacterized peroxidase-related enzyme (TIGR01926; HMM-score: 41.8)
    Unknown functionGeneralalkylhydroperoxidase AhpD family core domain (TIGR00778; HMM-score: 40.8)
    alkylhydroperoxidase domain protein, Avi_7169 family (TIGR04030; HMM-score: 31.3)
    Cellular processesCellular processesDetoxificationalkylhydroperoxidase, AhpD family (TIGR00777; EC 1.11.1.15; HMM-score: 24.2)
    alkylhydroperoxidase/carboxymuconolactone decarboxylase family protein (TIGR04169; HMM-score: 14.9)
  • TheSEED:
  • PFAM:
    AhpD-like (CL0423) CMD; Carboxymuconolactone decarboxylase family (PF02627; HMM-score: 37.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 26
    • Smax: 0.195
    • Smax_pos: 2
    • Smean: 0.143
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447069507 NCBI
  • RefSeq: WP_001146763 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKELGVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDLVFVVNQINGWNRLNIISDRL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS13660 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]