From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14025 [old locus tag: NWMN_2441 ]
  • pan locus tag?: SAUPAN006199000
  • symbol: NWMN_RS14025
  • pan gene symbol?: cidR
  • synonym:
  • product: LysR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14025 [old locus tag: NWMN_2441 ]
  • symbol: NWMN_RS14025
  • product: LysR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2683760..2684623
  • length: 864
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2683760..2684623) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAATATTTTATTGAAGTCGTTAAGCAAGGAGGCATGACTAATGCTTCCAAATCATTA
    TATATTGCACAACCTACAATTAGTAAAGCAATTAAAGATATTGAAAATGAAATGGGCACG
    CCCTTATTTGATAGAAGTAAAAGACATTTAATTCTTACCGATGCAGGTCAAATTTTTTAT
    GAGAAAAGTAAAGAAATTGTTGCACTGTATGATTATTTACCATCTGAAATGGAACGCTTG
    AATGGACTGGAAACAGGACATATAAACATGGGCATGTCGGCAGTCATGAATATGAAGATT
    CTTATCAATATTCTTGGTGCATTCCATCAACAATATCCAAATGTTACATATAATTTGATA
    GAAAATGGCGGTAAAACAATTGAACAGCAAATTATCAATGATGAAGTAGATATAGGCGTG
    ACCACTTTGCCAGTCGATCATCATATTTTCGATTATACTACCCTAGATAAGGAAGATTTG
    CGACTTATCGTGAGCAGAGAGCATCGACTCGCAAAATATGAAACTGTTAAACTCGAAGAT
    TTAGCAGGTGAAGACTTCATTTTATTTAATAAAGACTTTTACTTGAATGATAAAATTATT
    GAAAATGCTAAAAACGTTGGCTTTGTTCCGAATACTGTAGCGCAAATTTCACAATGGCAT
    GTTATAGAAGATTTAGTTACGAATGAATTAGGTATTAGTATTTTACCAACATCAATTTCA
    GAGCAACTAAATGGAGATGTGAAGCTGCTACGCATTGAAGATGCTCATGTACATTGGGAA
    TTAGGTGTTGTTTGGAAGAAGGATAAACAATTAAGTCATGCCACAACGAAATGGATAGAA
    TTTTTGAAAGACCGTTTAGGCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    864

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14025 [old locus tag: NWMN_2441 ]
  • symbol: NWMN_RS14025
  • description: LysR family transcriptional regulator
  • length: 287
  • theoretical pI: 5.22208
  • theoretical MW: 32846.4
  • GRAVY: -0.225784

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 131.4)
    MetabolismEnergy metabolismOtherpca operon transcription factor PcaQ (TIGR02424; HMM-score: 82.9)
    Signal transductionRegulatory functionsDNA interactionspca operon transcription factor PcaQ (TIGR02424; HMM-score: 82.9)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 53.7)
    Cellular processesCellular processesToxin production and resistancetranscriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairtranscriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Signal transductionRegulatory functionsDNA interactionsD-serine deaminase transcriptional activator (TIGR02036; HMM-score: 33.9)
    MetabolismFatty acid and phospholipid metabolismBiosynthesispoly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 15.1)
  • TheSEED:
  • PFAM:
    PBP (CL0177) LysR_substrate; LysR substrate binding domain (PF03466; HMM-score: 143.8)
    HTH (CL0123) HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 64.4)
    no clan definedERp29; Endoplasmic reticulum protein ERp29, C-terminal domain (PF07749; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.197
    • Ymax_pos: 31
    • Cmax: 0.258
    • Cmax_pos: 31
    • Smax: 0.209
    • Smax_pos: 29
    • Smean: 0.143
    • D: 0.176
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001549809 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLILTDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQYPNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAKYETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGISILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14025 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]