From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14240 [old locus tag: NWMN_2480 ]
  • pan locus tag?: SAUPAN006257000
  • symbol: NWMN_RS14240
  • pan gene symbol?:
  • synonym:
  • product: alpha/beta hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14240 [old locus tag: NWMN_2480 ]
  • symbol: NWMN_RS14240
  • product: alpha/beta hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 2726855..2727685
  • length: 831
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2726855..2727685) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGAAACTTTAGAATTACAAGGCGCTAAATTACGATACCACCAAGTCGGACAAGGACCC
    GTGCTCATCTTTATTCCTGGTGCAAACGGTACCGGAGACATTTTTCTGCCTCTTGCAGAA
    CAGTTAAAAGACCATTTTACTGTTGTAGCCGTTGATCGTCGTGATTATGGAGAAAGCGAG
    TTAACTGAACCACTCCCTGATTCCGCTTCAAACCCTGACAGTGATTATCGTGTCAAACGC
    GACGCACAGGACATTGCCGAACTTGCAAAGTCATTAAGTGATGAACCTGTCTATATATTA
    GGTTCAAGTTCAGGTTCAATCGTTGCGATGCATGTGTTAAAAGATTACCCTGAAGTCGTT
    AAAAAGATTGCATTTCACGAACCACCAATTAATACATTTTTACCAGACAGTACTTATTGG
    AAAGATAAAAATGATGACATTGTGCATCAAATTTTAACAGAAGGCTTAGAAAAAGGCATG
    AAAACATTTGGCGAAACATTAAATATCGCACCAATTGATGCAAAAATGATGTCTCAACCT
    GCTGATACTGAAGAAGGACGTATAGAACAGTACAAACGTACGATGTTCTGGTCAGAATTT
    GAAATTAGACAATATACGCATTCAGATATTACTTTGGATGATTTCACAAAATACAGCGAT
    AAAATCACCCTACTAAATGGGACAGATTCTAGAGGCTCCTTCCCACAAGATGTTAACTTT
    TATATAAATAAAGAAACTGGCATACCTATTGTAGATATTCCAGGCGGTCACTTAGGTTAT
    ATTCAAAAACCTGAAGGCTTTGCTGATGTATTATTAAATATGTGGGGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14240 [old locus tag: NWMN_2480 ]
  • symbol: NWMN_RS14240
  • description: alpha/beta hydrolase
  • length: 276
  • theoretical pI: 4.43681
  • theoretical MW: 31005.7
  • GRAVY: -0.426812

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismOther3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 40.6)
    pyrimidine utilization protein D (TIGR03611; HMM-score: 30.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 29.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinpimelyl-[acyl-carrier protein] methyl ester esterase (TIGR01738; EC 3.1.1.85; HMM-score: 27.9)
    proline-specific peptidase (TIGR01250; HMM-score: 24.2)
    MetabolismEnergy metabolismPhotosynthesisputative magnesium chelatase accessory protein (TIGR03056; HMM-score: 22.7)
    MetabolismEnergy metabolismOtherpoly(3-hydroxyalkanoate) depolymerase (TIGR02240; EC 3.1.1.-; HMM-score: 18.4)
    prolyl aminopeptidase (TIGR01249; EC 3.4.11.5; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 58.8)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 47.5)
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 31.2)
    Thioesterase; Thioesterase domain (PF00975; HMM-score: 15.1)
    Esterase; Putative esterase (PF00756; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 31
    • Cmax: 0.109
    • Cmax_pos: 31
    • Smax: 0.183
    • Smax_pos: 28
    • Smean: 0.108
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446371050 NCBI
  • RefSeq: WP_000448905 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESELTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVVKKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQPADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNFYINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14240 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]