From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14325 [old locus tag: NWMN_2496 ]
  • pan locus tag?: SAUPAN006293000
  • symbol: NWMN_RS14325
  • pan gene symbol?: panB
  • synonym:
  • product: 3-methyl-2-oxobutanoate hydroxymethyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14325 [old locus tag: NWMN_2496 ]
  • symbol: NWMN_RS14325
  • product: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2741011..2741829
  • length: 819
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2741011..2741829) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    TTGAAAACAGTAAGTCAATTAATAGATATGAAACAAAAGCAAACTAAAATTTCTATGGTA
    ACAGCTTATGATTTTCCAAGTGCTAAACAAGTGGAAGCAGCGGGTATTGATATGATTCTT
    GTTGGGGATTCACTTGGTATGACTGTATTAGGTTATGAAAGTATCGTACAAGTGACGTTA
    GCAGATATGATTCATCACGGTCGTGCAGTAAGAAGAGGCGCACCAAATACATTTGTAGTT
    GTTGATATGCCGATTGGTGCAGTAGGCATCTCTATGACACAAGACTTAAATCATGCTCTA
    AAGCTTTATCAGGAGACGAATGCAAATGCAATTAAAGCAGAAGGAGCGCATATTACACCA
    TTTATTGAAAAAGCAACGGCAATTGGTATTCCTGTTGTTGCACATTTAGGATTAACACCT
    CAAAGTGTTGGCGTTATGGGGTATAAATTACAAGGTGCAACGAAAGAAGCAGCGGAGCAA
    CTTATTTTAGACGCGAAAAATGTAGAACAAGCTGGTGCAGTTGCGTTAGTACTTGAAGCA
    ATTCCAAATGATTTAGCAGAAGAAATTAGCAAGCACTTAACAATTCCAGTCATTGGTATT
    GGTGCAGGAAAAGGTACAGATGGTCAAGTATTGGTTTATCACGATATGTTAAATTATGGT
    GTTGAACATAAAGCGAAATTTGTGAAGCAATTTGCTGATTTTAGTGTTGGTGTGGATGGT
    TTAAAACAATACGATCAAGAAGTTAAATCTGGTGCATTTCCATCAGAAGAATATACGTAT
    AAAAAGAAAATTATGAATGAGGTTAATAACAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    819

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14325 [old locus tag: NWMN_2496 ]
  • symbol: NWMN_RS14325
  • description: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • length: 272
  • theoretical pI: 5.84619
  • theoretical MW: 29267.5
  • GRAVY: 0.00294118

Function[edit source | edit]

  • reaction:
    EC 2.1.2.11?  ExPASy
    3-methyl-2-oxobutanoate hydroxymethyltransferase5,10-methylenetetrahydrofolate + 3-methyl-2-oxobutanoate + H2O = tetrahydrofolate + 2-dehydropantoate
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme A3-methyl-2-oxobutanoate hydroxymethyltransferase (TIGR00222; EC 2.1.2.11; HMM-score: 294.2)
    MetabolismEnergy metabolismAmino acids and aminesaspartate racemase (TIGR00035; EC 5.1.1.13; HMM-score: 13.7)
  • TheSEED:
  • PFAM:
    PK_TIM (CL0151) Pantoate_transf; Ketopantoate hydroxymethyltransferase (PF02548; HMM-score: 320.3)
    PEP_mutase; Phosphoenolpyruvate phosphomutase (PF13714; HMM-score: 19.2)
    TIM_barrel (CL0036) NanE; Putative N-acetylmannosamine-6-phosphate epimerase (PF04131; HMM-score: 15.5)
    Leu-IlvD (CL0364) PA; PA domain (PF02225; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.216
    • Ymax_pos: 34
    • Cmax: 0.354
    • Cmax_pos: 34
    • Smax: 0.291
    • Smax_pos: 12
    • Smean: 0.174
    • D: 0.199
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446782787 NCBI
  • RefSeq: WP_000860043 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKTVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESIVQVTLADMIHHGRAVRRGAPNTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGAHITPFIEKATAIGIPVVAHLGLTPQSVGVMGYKLQGATKEAAEQLILDAKNVEQAGAVALVLEAIPNDLAEEISKHLTIPVIGIGAGKGTDGQVLVYHDMLNYGVEHKAKFVKQFADFSVGVDGLKQYDQEVKSGAFPSEEYTYKKKIMNEVNNND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14325 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]