From AureoWiki
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
Contents
⊟Summary[edit source | edit]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS14405
- pan locus tag?:
- symbol: NWMN_RS14405
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit source | edit]
⊟Gene[edit source | edit]
⊟General[edit source | edit]
- type: CDS
- locus tag: NWMN_RS14405
- symbol: NWMN_RS14405
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2758939..2759034
- length: 96
- essential: unknown
⊟Accession numbers[edit source | edit]
- Location: NC_009641 (2758939..2759034) NCBI
- MicrobesOnline:
⊟Phenotype[edit source | edit]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit source | edit]
- 1
61ATGAAAAATGTGTCAATTTACAAAACAACTCAAGAATTAAGTTTTGTAAGTTCGTTAGAT
TTTTATTTAACGAAACATTTAACTTTAATGCTTTAA60
96
⊟Protein[edit source | edit]
⊟General[edit source | edit]
- locus tag: NWMN_RS14405
- symbol: NWMN_RS14405
- description: hypothetical protein
- length: 31
- theoretical pI: 9.10239
- theoretical MW: 3652.3
- GRAVY: 0.245161
⊟Function[edit source | edit]
- reaction:
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & interactions[edit source | edit]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit source | edit]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- Ymax: 0.13
- Ymax_pos: 11
- Cmax: 0.105
- Cmax_pos: 23
- Smax: 0.267
- Smax_pos: 1
- Smean: 0.144
- D: 0.135
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit source | edit]
⊟Protein sequence[edit source | edit]
- MKNVSIYKTTQELSFVSSLDFYLTKHLTLML
⊟Experimental data[edit source | edit]
- experimentally validated: no data available
⊟Expression & Regulation[edit source | edit]
⊟Operon[edit source | edit]
- NWMN_RS14405 no polycistronic organisation predicted
⊟Regulation[edit source | edit]
- sigma factor:
- regulator:
⊟Transcription pattern[edit source | edit]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit source | edit]
- Aureolib: no data available
⊟Protein stability[edit source | edit]
- half-life: no data available
⊟Biological Material[edit source | edit]
⊟Mutants[edit source | edit]
⊟Expression vector[edit source | edit]
⊟lacZ fusion[edit source | edit]
⊟GFP fusion[edit source | edit]
⊟two-hybrid system[edit source | edit]
⊟FLAG-tag construct[edit source | edit]
⊟Antibody[edit source | edit]
⊟Other Information[edit source | edit]
You are kindly invited to share additional interesting facts.
