From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14755 [old locus tag: NWMN_2571 ]
  • pan locus tag?: SAUPAN006428000
  • symbol: NWMN_RS14755
  • pan gene symbol?: hisF
  • synonym:
  • product: imidazole glycerol phosphate synthase cyclase subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14755 [old locus tag: NWMN_2571 ]
  • symbol: NWMN_RS14755
  • product: imidazole glycerol phosphate synthase cyclase subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2840337..2841095
  • length: 759
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2840337..2841095) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTAAAAAACGTATCATTCCATGTTTAGATGTCAAAGATGGTCGTGTCGTTAAAGGG
    ATTCAATTTAAAGGATTAAGGGATATTGGGAATCCTGTTGATTTAGCAATGTATTACAAT
    GAAGCGGGTGCTGATGAATTAGTATTTTTAGACATCTCTAAGACGGAAGAGGGTCATAGC
    TTAATGCTAGAAGTGATTGAACAGACAGCGTCACGCTTGTTTATCCCTCTTACTGTAGGG
    GGTGGGATTCAAAGTCTCGATGATATTACCCAATTGCTAAATCATGGTGCAGATAAAGTA
    TCATTAAATTCAAGTGCTTTAAAAAATCCACAGCTCATTAAACAAGCGAGTGATAAATTC
    GGTAGACAATGCATCTGCATAGCAATTGATAGCTATTATGATCCTGAAAGAAAAGCACAT
    TATTGTTGTACGACTGGTGGTAAAAAAATGACAAATATTAAAGTATATGACTGGGTACAG
    CAAGTAGAACAGTTAGGTGCAGGTGAGCTCCTCGTTACAAGTATGGGACATGATGGTATG
    AAACAAGGCTTTGATATTGAACACCTAGCAAATATTAAGTCTCTTGTAAATATTCCAATC
    ATTGCTTCTGGTGGTGGTGGCAATGCACAACACTTTGTAGAATTATTTGATCAGACGGAT
    GTTTCTGCAGGTTTAGCTGCAAGTATATTACATGATCGAGAAACGACGGTTCAATCTATT
    AAAGAAGTGATACGGCAAGGGGGTATAGCAGTAAGATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14755 [old locus tag: NWMN_2571 ]
  • symbol: NWMN_RS14755
  • description: imidazole glycerol phosphate synthase cyclase subunit
  • length: 252
  • theoretical pI: 6.15747
  • theoretical MW: 27498.4
  • GRAVY: -0.097619

Function[edit source | edit]

  • reaction:
    EC 4.1.3.-?  ExPASy
    5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide + L-glutamine = imidazole-glycerol phosphate + 5-aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H2O?
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyimidazoleglycerol phosphate synthase, cyclase subunit (TIGR00735; HMM-score: 334.3)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 271.3)
    MetabolismAmino acid biosynthesisHistidine family1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 118.7)
    bifunctional HisA/TrpF protein (TIGR01919; EC 5.3.1.16,5.3.1.24; HMM-score: 74.2)
    Unknown functionGeneralhisA/hisF family protein (TIGR00734; HMM-score: 34.6)
    MetabolismAmino acid biosynthesisHistidine familyphosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (TIGR02129; EC 5.3.1.16; HMM-score: 33.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine-phosphate diphosphorylase (TIGR00693; EC 2.5.1.3; HMM-score: 24.3)
    Unknown functionGeneralputative TIM-barrel protein, nifR3 family (TIGR00737; HMM-score: 18.7)
    geranylgeranylglyceryl phosphate synthase family protein (TIGR01768; EC 2.5.1.-; HMM-score: 16.2)
    dihydroorotate dehydrogenase family protein (TIGR01037; EC 1.3.-.-; HMM-score: 14.3)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisfructose-1,6-bisphosphate aldolase, class II (TIGR01859; EC 4.1.2.13; HMM-score: 14.2)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA dihydrouridine synthase A (TIGR00742; EC 1.-.-.-; HMM-score: 13.6)
    mycofactocin system FadH/OYE family oxidoreductase 2 (TIGR03997; EC 1.-.-.-; HMM-score: 12.9)
    phosphoglycerol geranylgeranyltransferase (TIGR01769; EC 2.5.1.41; HMM-score: 12.3)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 266.3)
    Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 29.3)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 26.6)
    NMO; Nitronate monooxygenase (PF03060; HMM-score: 21.7)
    G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 20)
    PK_TIM (CL0151) PEP_mutase; Phosphoenolpyruvate phosphomutase (PF13714; HMM-score: 13.8)
    TIM_barrel (CL0036) ThiG; Thiazole biosynthesis protein ThiG (PF05690; HMM-score: 13)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.135
    • Ymax_pos: 11
    • Cmax: 0.23
    • Cmax_pos: 45
    • Smax: 0.221
    • Smax_pos: 2
    • Smean: 0.183
    • D: 0.153
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446515263 NCBI
  • RefSeq: WP_000592609 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKFGRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGMKQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSIKEVIRQGGIAVR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14755 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]