From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14935 [old locus tag: NWMN_2608 ]
  • pan locus tag?: SAUPAN006482000
  • symbol: NWMN_RS14935
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14935 [old locus tag: NWMN_2608 ]
  • symbol: NWMN_RS14935
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2872202..2872555
  • length: 354
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2872202..2872555) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTTTTCAATTGGAAGTGCAATTCTTCATTTTGTCATTGGTGGTATCGCTGTTGCATTA
    GCTTCAATTATTGCTGATAAGGTAGGTGGTAAGTTAGGAGGTATTATAGCTACTATGCCG
    GCAGTCTTTCTTGCGGCTATTATCGCATTAGCTTTAGATCATCGTGGTACGCAATTAGTG
    GAGATGTCGATGAATCTTAGTACTGGAGCAATTGTCGGTATTCTGTCTTGTATATTAACT
    GTATTTTTGACATCTCTCTACATTAAGCATAAAGGTTATCGGAAAGGCGCAATATTCACA
    GTTGTTTGTTGGTTTGTCATTTCCCTCGCAATATTCAGTATTAGACATTTATAG
    60
    120
    180
    240
    300
    354

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS14935 [old locus tag: NWMN_2608 ]
  • symbol: NWMN_RS14935
  • description: hypothetical protein
  • length: 117
  • theoretical pI: 10.178
  • theoretical MW: 12330.9
  • GRAVY: 1.2735

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substrateMFS transporter, metabolite:H+ symporter (MHS) family protein (TIGR00883; HMM-score: 13.5)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 5.4)
  • TheSEED:
  • PFAM:
    GlpM-like (CL0420) DUF3147; Protein of unknown function (DUF3147) (PF11345; HMM-score: 153)
    no clan definedChromate_transp; Chromate transporter (PF02417; HMM-score: 13.4)
    DUF485; Protein of unknown function, DUF485 (PF04341; HMM-score: 8.9)
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 6.7)
    Apoptosis-Inhib (CL0453) BaxI_1; Bax inhibitor 1 like (PF12811; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.196
    • Ymax_pos: 20
    • Cmax: 0.181
    • Cmax_pos: 52
    • Smax: 0.331
    • Smax_pos: 11
    • Smean: 0.268
    • D: 0.224
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 446413527 NCBI
  • RefSeq: WP_000491382 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLVEMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS14935 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]