From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0035
  • pan locus tag?: SAUPAN000087000
  • symbol: SA0035
  • pan gene symbol?:
  • synonym:
  • product: HMG-CoA synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0035
  • symbol: SA0035
  • product: HMG-CoA synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 42539..42880
  • length: 342
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATTTATACAGGATCATTATACTTAAGTTTAATTTCGTTATTACAGAACCACACATTCCAA
    CCAGAAGAGAAAGTATGTCTATTTAGTTATGGTTCAGGAGCAGTAGGAGAAATCTTTAGT
    GGTTCAATCGTTAAAGGATATGACAAAGCATTAGATAAAGAGAAACACTTAAATATGCTA
    GAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAAT
    CAAGAATTTGATTTCGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATAC
    AGTATAGAAGACCATATCAGAACATATAAGATAGAGAAATAA
    60
    120
    180
    240
    300
    342

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0035
  • symbol: SA0035
  • description: HMG-CoA synthase
  • length: 113
  • theoretical pI: 4.53054
  • theoretical MW: 13360.8
  • GRAVY: -0.566372

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    hydroxymethylglutaryl-CoA synthase (TIGR01835; EC 2.3.3.10; HMM-score: 97.8)
    hydroxymethylglutaryl-CoA synthase (TIGR01833; EC 2.3.3.10; HMM-score: 35.4)
    hopanoid biosynthesis associated membrane protein HpnM (TIGR03481; HMM-score: 11.6)
  • TheSEED:  
    Hydroxymethylglutaryl-CoA synthase N-domain homolog (EC 2.3.3.10) 
  • PFAM:
    Thiolase (CL0046) HMG_CoA_synt_C; Hydroxymethylglutaryl-coenzyme A synthase C terminal (PF08540; HMM-score: 39.7)
    GT-A (CL0110) CgtA; Beta-1,4-N-acetylgalactosaminyltransferase (CgtA) (PF06306; HMM-score: 14.3)
    tRNA_synt_II (CL0040) tRNA-synt_2e; Glycyl-tRNA synthetase alpha subunit (PF02091; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.237
    • Ymax_pos: 22
    • Cmax: 0.223
    • Cmax_pos: 22
    • Smax: 0.356
    • Smax_pos: 18
    • Smean: 0.22
    • D: 0.231
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYTGSLYLSLISLLQNHTFQPEEKVCLFSYGSGAVGEIFSGSIVKGYDKALDKEKHLNMLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]