From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0107 [new locus tag: SA_RS00690 ]
  • pan locus tag?: SAUPAN000909000
  • symbol: spa
  • pan gene symbol?: spa
  • synonym:
  • product: immunoglobulin G binding protein A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0107 [new locus tag: SA_RS00690 ]
  • symbol: spa
  • product: immunoglobulin G binding protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 122649..124001
  • length: 1353
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    TTGAAAAAGAAAAACATTTATTCAATTCGTAAACTAGGTGTAGGTATTGCATCTGTAACT
    TTAGGTACATTACTTATATCTGGTGGCGTAACACCTGCTGCAAATGCTGCGCAACACGAT
    GAAGCTCAACAAAATGCTTTTTATCAAGTGTTAAATATGCCTAACTTAAACGCTGATCAA
    CGTAATGGTTTTATCCAAAGCCTTAAAGATGATCCAAGCCAAAGTGCTAACGTTTTAGGT
    GAAGCTCAAAAACTTAATGACTCTCAAGCTCCAAAAGCTGATGCGCAACAAAATAACTTC
    AACAAAGATCAACAAAGCGCCTTCTATGAAATCTTGAACATGCCTAACTTAAACGAAGCG
    CAACGTAACGGCTTCATTCAAAGTCTTAAAGACGACCCAAGCCAAAGCACTAATGTTTTA
    GGTGAAGCTAAAAAATTAAACGAATCTCAAGCACCGAAAGCTGATAACAATTTCAACAAA
    GAACAACAAAATGCTTTCTATGAAATCTTGAATATGCCTAACTTAAACGAAGAACAACGC
    AATGGTTTCATCCAAAGCTTAAAAGATGACCCAAGCCAAAGTGCTAACCTATTGTCAGAA
    GCTAAAAAGTTAAATGAATCTCAAGCACCGAAAGCGGATAACAAATTCAACAAAGAACAA
    CAAAATGCTTTCTATGAAATCTTACATTTACCTAACTTAAACGAAGAACAACGTAACGGC
    TTCATCCAAAGCCTTAAAGACGATCCTTCAGTGAGCAAAGAAATTTTAGCAGAAGCTAAA
    AAGCTAAACGATGCTCAAGCACCAAAAGAGGAAGACAACAAAAAACCTGGTAAAGAAGAC
    GGCAACAAACCTGGCAAAGAAGACGGCAACAAGCCTGGTAAAGAAGACAACAAAAAACCT
    GGTAAAGAAGACGGCAACAAGCCTGGTAAAGAAGACAACAACAAACCTGGCAAAGAAGAC
    GGCAACAAGCCTGGTAAAGAAGACAACAACAAGCCTGGTAAAGAAGACGGCAACAAGCCT
    GGTAAAGAAGACGGCAACAAACCTGGTAAAGAAGACGGCAACGGAGTACATGTCGTTAAA
    CCTGGTGATACAGTAAATGACATTGCAAAAGCAAACGGCACTACTGCTGACAAAATTGCT
    GCAGATAACAAATTAGCTGATAAAAACATGATCAAACCTGGTCAAGAACTTGTTGTTGAT
    AAGAAGCAACCAGCAAACCATGCAGATGCTAACAAAGCTCAAGCATTACCAGAAACTGGT
    GAAGAAAATCCATTCATCGGTACAACTGTATTTGGTGGATTATCATTAGCCTTAGGTGCA
    GCGTTATTAGCTGGACGTCGTCGCGAACTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1353

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0107 [new locus tag: SA_RS00690 ]
  • symbol: Spa
  • description: immunoglobulin G binding protein A
  • length: 450
  • theoretical pI: 5.46895
  • theoretical MW: 48872.5
  • GRAVY: -1.13111

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    gram-positive signal peptide, YSIRK family (TIGR01168; HMM-score: 34.8)
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 19.6)
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 17.8)
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionAdhesins in Staphylococcus Protein A, von Willebrand factor binding protein Spa 
  • PFAM:
    B_GA (CL0598) B; B domain (PF02216; HMM-score: 380.3)
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 48.9)
    B_GA (CL0598) GA; GA module (PF01468; HMM-score: 45.8)
    no clan definedYSIRK_signal; YSIRK type signal peptide (PF04650; HMM-score: 38.6)
    Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 38.6)
    Octapeptide; Octapeptide repeat (PF03373; HMM-score: 30.8)
    Dim_A_B_barrel (CL0032) DUF3291; Domain of unknown function (DUF3291) (PF11695; HMM-score: 15.8)
    no clan definedIFT43; Intraflagellar transport protein 43 (PF15305; HMM-score: 14.7)
    NTS_2; N-terminal segments of P. falciparum erythrocyte membrane protein (PF15448; HMM-score: 10.2)
    DUF148; Domain of unknown function DUF148 (PF02520; HMM-score: 8.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA1510(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA1532hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 9.98
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: LPxTG Cell-wall anchored
    • Prediction by SwissProt Classification: Cell Wall
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: found LPxTG motif :LPETG
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.746
    • Ymax_pos: 37
    • Cmax: 0.674
    • Cmax_pos: 37
    • Smax: 0.91
    • Smax_pos: 27
    • Smean: 0.78
    • D: 0.759
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

T J Foster, M Höök
Surface protein adhesins of Staphylococcus aureus.
Trends Microbiol.: 1998, 6(12);484-8
[PubMed:10036727] [WorldCat.org] (P p)
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)
Andrea C DeDent, Molly McAdow, Olaf Schneewind
Distribution of protein A on the surface of Staphylococcus aureus.
J. Bacteriol.: 2007, 189(12);4473-84
[PubMed:17416657] [WorldCat.org] [DOI] (P p)
Satoshi Sato, Alan R Fersht
Searching for multiple folding pathways of a nearly symmetrical protein: temperature dependent phi-value analysis of the B domain of protein A.
J. Mol. Biol.: 2007, 372(1);254-67
[PubMed:17628591] [WorldCat.org] [DOI] (P p)
Hwan Keun Kim, Vilasack Thammavongsa, Olaf Schneewind, Dominique Missiakas
Recurrent infections and immune evasion strategies of Staphylococcus aureus.
Curr. Opin. Microbiol.: 2012, 15(1);92-9
[PubMed:22088393] [WorldCat.org] [DOI] (I p)
Samuel Becker, Matthew B Frankel, Olaf Schneewind, Dominique Missiakas
Release of protein A from the cell wall of Staphylococcus aureus.
Proc. Natl. Acad. Sci. U.S.A.: 2014, 111(4);1574-9
[PubMed:24434550] [WorldCat.org] [DOI] (I p)