From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0348 [new locus tag: SA_RS01990 ]
  • pan locus tag?: SAUPAN001906000
  • symbol: SA0348
  • pan gene symbol?: parB
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0348 [new locus tag: SA_RS01990 ]
  • symbol: SA0348
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 408141..408977
  • length: 837
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    TTGTCAAAAAGTGAAGATCAACGTATTACTAAAACAAAAGATGAACAAATTAAGCAAATA
    GATATATCGGATATCAAACCGAATCCGTATCAGCCCCGAAAAACTTTCGATGAAAATCAT
    TTAAATGATTTGGCAGATTCAATTAAGCAATATGGAATTTTGCAACCAATTGTGCTTAGA
    AAAACAGTTCAAGGTTATTACATTGTAGTTGGTGAAAGAAGGTTTAGAGCTTCGAAAATT
    GCTGGTCTAAAATACGTATCAGCGATTATCAAAGATTTAACAGATGAAGATATGATGGAA
    CTGGCGGTCATCGAAAATTTACAACGAGAAGACTTAAATGCGATTGAAGAAGCTGAAAGT
    TATCAACGTTTGATGACAGATTTGAAAATTACACAACAAGAAGTAGCGAAGCGATTGAGT
    AAGTCGCGCCCGTATATAGCGAATATGTTGAGGTTATTACATTTGCCGAAAAAGATTGCT
    GACATGGTAAAAGATGGGCGACTGACAAGTGCACATGGACGAACGTTATTGGCAATTAAA
    GATGAACAACAAATGCTTAGGTTAGCGAAACGGGTTGTTAAAGAAAAGTGGAGTGTTAGA
    TATTTAGAAAACCATGTTAATGAATTAAAAAATGTTTCGTCAAAGTCGGAAACAGACAAA
    GTAGATATAACTAAGCCTAAATTTATAAAGCAACAAGAACGACAGTTGCGAGAACAGTAT
    GGTACCAAAGTAGATATATCAATAAAAAAATCGGTTGGTAAAATCTCATTTGAGTTTGAT
    TCACAAGATGACTTTGTGAGAATAATTGAACAATTAAATCGTAGGTATGGTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    837

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0348 [new locus tag: SA_RS01990 ]
  • symbol: SA0348
  • description: hypothetical protein
  • length: 278
  • theoretical pI: 10.0767
  • theoretical MW: 32512.2
  • GRAVY: -0.718345

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    nucleoid occlusion protein (TIGR04285; HMM-score: 248.8)
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 195.1)
    PRTRC system ParB family protein (TIGR03734; HMM-score: 118.7)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid partitioning protein RepB (TIGR03454; HMM-score: 70.5)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryBacterial Cytoskeleton Chromosome (plasmid) partitioning protein ParB 
    Cell Division and Cell Cycle - no subcategoryTwo cell division clusters relating to chromosome partitioning Chromosome (plasmid) partitioning protein ParB 
    Cell Division Subsystem including YidCD Chromosome (plasmid) partitioning protein ParB 
  • PFAM:
    ParBc (CL0248) ParBc; ParB-like nuclease domain (PF02195; HMM-score: 94.4)
    no clan definedLatarcin; Latarcin precursor (PF10279; HMM-score: 21.8)
    PDDEXK (CL0236) DUF1016; Protein of unknown function (DUF1016) (PF06250; HMM-score: 17.4)
    HTH (CL0123) KorB; KorB domain (PF08535; HMM-score: 17.1)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 16.7)
    no clan definedDUF3861; Domain of Unknown Function with PDB structure (DUF3861) (PF12977; HMM-score: 14.7)
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 13.7)
    MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 13.3)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 12.9)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 12.5)
    no clan definedCbeA_antitoxin; CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A (PF06154; HMM-score: 12.5)
    HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 12.1)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 9.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 11
    • Cmax: 0.104
    • Cmax_pos: 36
    • Smax: 0.133
    • Smax_pos: 3
    • Smean: 0.093
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPIVLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEEAESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLLAIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLREQYGTKVDISIKKSVGKISFEFDSQDDFVRIIEQLNRRYGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]