From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0363 [new locus tag: SA_RS02080 ]
  • pan locus tag?: SAUPAN001978000
  • symbol: SA0363
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0363 [new locus tag: SA_RS02080 ]
  • symbol: SA0363
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 419940..420566
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAGAGATTACTACTAAGTACATTTTTAGCATCTGCATTAATTCTTACAGGTTGC
    GCGTCCGATCAATCTGATAACGAAGATCATCACACAAGTACTGGCATCCATGCACCTAAA
    AGCGCTAAAAAATTAGAAACAAAAGATATCTTTAACTCAGATAAGAAAAATAGTGATATT
    AGTGATGCAGAGATGAAGCAAGCTATAGAAAAGTATTTGTCTGTAAATAGCGATATACTT
    GATAACAAATATATTATGCAACATAAACTAGATAAACAAATTGACAGTCAAACAAAAGTG
    ACTGAAAAACAAGCAGAAACACTTAGCCACTTATCTAACTTAGCTGTTAAAAACGATTTG
    CATTTCAAGAAATTTGTCACTGAAAACAATATTCCTAAAGAATATAAGAAACCCGTTGAA
    TTAATGATGAATTACTTCAAAGCTTTAAATAGTACAATCGCCAATGTTGATGAAGATATT
    GAAAAGCTTAGCTATCAACCGCAAAATAAAATCAATGTAGTCGACGTGCCAACAAAATAT
    GCCGGTGATGTTAATAAAAAGCAACAAGATAAAATTAAAGATTTCTTAAAATCTAAAGGT
    ATCAAGAGTGATGTTATCGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0363 [new locus tag: SA_RS02080 ]
  • symbol: SA0363
  • description: hypothetical protein
  • length: 208
  • theoretical pI: 9.1737
  • theoretical MW: 23633.8
  • GRAVY: -0.747115

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 20.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 19.3)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 12)
  • TheSEED:  
    FIG01108125: hypothetical protein 
  • PFAM:
    no clan definedPilus_CpaD; Pilus biogenesis CpaD protein (pilus_cpaD) (PF09476; HMM-score: 14.5)
    DUF1748; Fungal protein of unknown function (DUF1748) (PF08520; HMM-score: 13.7)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 11.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: LILTGCA
  • SignalP: Signal peptide length 24 aa
    • Ymax: 0.428
    • Ymax_pos: 24
    • Cmax: 0.207
    • Cmax_pos: 24
    • Smax: 0.957
    • Smax_pos: 6
    • Smean: 0.905
    • D: 0.614
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKLETKDIFNSDKKNSDISDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQAETLSHLSNLAVKNDLHFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKLSYQPQNKINVVDVPTKYAGDVNKKQQDKIKDFLKSKGIKSDVIDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]