From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0407 [new locus tag: SA_RS02325 ]
  • pan locus tag?: SAUPAN002149000
  • symbol: SA0407
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0407 [new locus tag: SA_RS02325 ]
  • symbol: SA0407
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 466813..467136
  • length: 324
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATGTTTAATCAAATTAATAATAAAAATGAATTAGAAGAATCATATGAATCTGAGAAA
    AAACGTATAGAGAATGAACTGCATAATTTAAATGAACTTAGGCATAGAACTCGAAAAGAA
    AATGAACGTAGTTATGATGTTTTTCAATATTTGAAGCACGAAATGAATTATAGTGAAGAT
    GCCCAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
    AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAGTCTTATGAAAAG
    CAGTTAGATAAACTAAGTGACTGA
    60
    120
    180
    240
    300
    324

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0407 [new locus tag: SA_RS02325 ]
  • symbol: SA0407
  • description: hypothetical protein
  • length: 107
  • theoretical pI: 5.12494
  • theoretical MW: 13466.8
  • GRAVY: -1.68972

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02169; HMM-score: 9.7)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02169; HMM-score: 9.7)
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 5.6)
    two transmembrane protein (TIGR04527; HMM-score: 4.8)
    Genetic information processingTranscriptionDegradation of RNAribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 2.9)
  • TheSEED:  
    FIG01107979: hypothetical protein 
  • PFAM:
    dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 14.3)
    no clan definedKxDL; Uncharacterized conserved protein (PF10241; HMM-score: 13.6)
    6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.1)
    no clan definedDUF2959; Protein of unknown function (DUF2959) (PF11172; HMM-score: 11.6)
    Tup_N; Tup N-terminal (PF08581; HMM-score: 10.2)
    HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 9.7)
    YlqD; YlqD protein (PF11068; HMM-score: 9.6)
    HAUS6_N; HAUS augmin-like complex subunit 6 N-terminus (PF14661; HMM-score: 8.4)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 8.1)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 7.8)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 7.7)
    OmpH; Outer membrane protein (OmpH-like) (PF03938; HMM-score: 6.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 18
    • Cmax: 0.105
    • Cmax_pos: 18
    • Smax: 0.41
    • Smax_pos: 11
    • Smean: 0.26
    • D: 0.209
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMFNQINNKNELEESYESEKKRIENELHNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDKLSD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]