From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0529 [new locus tag: SA_RS03075 ]
  • pan locus tag?: SAUPAN002348000
  • symbol: SA0529
  • pan gene symbol?: hxlB
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0529 [new locus tag: SA_RS03075 ]
  • symbol: SA0529
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 623586..624134
  • length: 549
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCTAAATTTAGTGACTATCAATTAATTCTAGATGAATTAAAGATGACTTTGTCACAT
    GTTGAAGCGGATGAGTTTTCAACTTTTGCATCCAAAATACTACATGCTGAACATATATTT
    GTAGCTGGCAAAGGACGTTCAGGATTCGTGGCGAATAGTTTTGCAATGCGCTTAAATCAG
    CTCGGCAAACAGGCACATGTTGTTGGAGAATCAACGACACCTGCGATTAAGTCGAATGAT
    GTATTTGTAATTATCTCTGGTTCAGGTTCCACGGAACATTTAAGATTATTAGCAGACAAA
    GCAAAATCAGTAGGTGCTGACATCGTATTAATTACTACAAATAAAGATTCTGCAATAGGC
    AATCTAGCTGGGACGAACATCGTTTTGCCTGCAGGTACAAAATATGATGAACAAGGCTCG
    GCACAACCATTAGGAAGTTTGTTTGAACAAGCATCTCAATTATTTTTAGATAGTGTTGTA
    ATGGGATTGATGACTGAAATGAATGTTACGGAACAAACGATGCAACAAAATCATGCTAAT
    TTAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0529 [new locus tag: SA_RS03075 ]
  • symbol: SA0529
  • description: hypothetical protein
  • length: 182
  • theoretical pI: 5.19307
  • theoretical MW: 19558.1
  • GRAVY: -0.00274725

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    6-phospho 3-hexuloisomerase (TIGR03127; EC 5.3.-.-; HMM-score: 226.1)
    MetabolismEnergy metabolismSugarssugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 29.7)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanN-acetylmuramic acid 6-phosphate etherase (TIGR00274; EC 4.2.1.126; HMM-score: 23.2)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanglutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    MetabolismCentral intermediary metabolismAmino sugarsglutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    bifunctional phosphoglucose/phosphomannose isomerase (TIGR02128; EC 5.3.1.9; HMM-score: 18)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylglycinamide formyltransferase (TIGR00639; EC 2.1.2.2; HMM-score: 12.2)
  • TheSEED:  
    CarbohydratesOne-carbon MetabolismFormaldehyde assimilation: Ribulose monophosphate pathway 6-phospho-3-hexuloisomerase (EC 5.3.1.27) 
  • PFAM:
    SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 67.6)
    SIS_2; SIS domain (PF13580; HMM-score: 24.6)
    no clan definedFormyl_trans_N; Formyl transferase (PF00551; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.169
    • Ymax_pos: 24
    • Cmax: 0.264
    • Cmax_pos: 24
    • Smax: 0.145
    • Smax_pos: 62
    • Smean: 0.099
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHANLE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]