From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0562 [new locus tag: SA_RS03250 ]
  • pan locus tag?: SAUPAN002470000
  • symbol: adh1
  • pan gene symbol?: adh1
  • synonym:
  • product: alcohol dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0562 [new locus tag: SA_RS03250 ]
  • symbol: adh1
  • product: alcohol dehydrogenase
  • replicon: chromosome
  • strand: +
  • coordinates: 655557..656567
  • length: 1011
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAGAGCAGCAGTTGTAACGAAAGATCACAAAGTAAGTATTGAGGACAAAAAGTTAAGA
    GCTTTAAAACCTGGTGAAGCATTGGTACAAACGGAATATTGTGGTGTTTGTCATACCGAT
    TTACATGTTAAGAATGCTGATTTTGGTGATGTTACAGGCGTTACTTTAGGTCATGAAGGT
    ATTGGTAAAGTCATCGAAGTTGCAGAAGATGTAGAATCATTAAAAATTGGAGACCGTGTG
    TCTATCGCTTGGATGTTCGAAAGCTGTGGAAGATGTGAATATTGTACAACAGGTCGTGAA
    ACACTTTGCCGTAGTGTGAAAAATGCTGGTTATACAGTAGATGGTGCAATGGCTGAACAA
    GTTATTGTTACTGCAGACTATGCTGTGAAAGTACCTGAAAAATTAGATCCAGCAGCAGCG
    TCTTCTATTACATGCGCAGGTGTGACAACTTATAAAGCTGTAAAAGTAAGTAATGTAAAA
    CCTGGTCAATGGTTAGGTGTTTTTGGTATAGGTGGTTTAGGTAACCTAGCTTTACAATAT
    GCTAAAAACGTTATGGGGGCTAAAATTGTTGCCTTCGACATTAATGATGATAAATTAGCA
    TTCGCGAAAGAATTAGGTGCAGATGCTATTATTAATTCTAAAGATGTTGATCCAGTTGCA
    GAAGTTATGAAATTAACTGATAACAAAGGATTAGATGCAACAGTGGTAACTTCAGTTGCT
    AAGACGCCATTTAACCAAGCGGTTGATGTTGTAAAAGCTGGTGCAAGAGTTGTTGCCGTT
    GGTTTACCTGTTGATAAAATGAACTTAGATATCCCAAGATTAGTGCTTGACGGTATTGAA
    GTAGTAGGTTCACTTGTTGGTACAAGACAAGACTTACGTGAAGCGTTTGAATTTGCTGCT
    GAAAATAAAGTAACACCTAAAGTTCAATTAAGAAAATTAGAAGAAATCAATGATATTTTT
    GAAGAAATGGAAAAGGGTACTATAACTGGTAGAATGGTTATTAAATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1011

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0562 [new locus tag: SA_RS03250 ]
  • symbol: Adh1
  • description: alcohol dehydrogenase
  • length: 336
  • theoretical pI: 5.31105
  • theoretical MW: 36061.4
  • GRAVY: 0.0443452

Function[edit source | edit]

  • reaction:
    EC 1.1.1.1?  ExPASy
    Alcohol dehydrogenaseAn alcohol + NAD+ = an aldehyde or ketone + NADHA secondary alcohol + NAD+ = a ketone + NADH
  • TIGRFAM:
    MetabolismEnergy metabolismFermentationzinc-binding alcohol dehydrogenase family protein (TIGR02822; EC 1.-.-.-; HMM-score: 156.3)
    Cellular processesCellular processesDetoxificationS-(hydroxymethyl)mycothiol dehydrogenase (TIGR03451; EC 1.1.1.306; HMM-score: 152.3)
    MetabolismEnergy metabolismAmino acids and aminesL-threonine 3-dehydrogenase (TIGR00692; EC 1.1.1.103; HMM-score: 144)
    Unknown functionEnzymes of unknown specificityNDMA-dependent alcohol dehydrogenase, Rxyl_3153 family (TIGR03989; EC 1.1.99.36; HMM-score: 137.1)
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 135.3)
    putative phosphonate catabolism associated alcohol dehydrogenase (TIGR03366; HMM-score: 119.3)
    Cellular processesCellular processesDetoxificationS-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 111.7)
    MetabolismEnergy metabolismFermentationS-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 111.7)
    Unknown functionEnzymes of unknown specificityputative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 100.2)
    MetabolismCentral intermediary metabolismOne-carbon metabolismformaldehyde dehydrogenase, glutathione-independent (TIGR02819; EC 1.2.1.46; HMM-score: 63.8)
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 63.4)
    Unknown functionEnzymes of unknown specificityputative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 59.7)
    MetabolismEnergy metabolismFermentationzinc-binding alcohol dehydrogenase family protein (TIGR02817; HMM-score: 36.3)
    leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase (TIGR02825; EC 1.3.1.48,1.3.1.74; HMM-score: 22.7)
    MetabolismEnergy metabolismElectron transportNADH oxidoreductase (quinone), F subunit (TIGR01959; EC 1.6.99.5; HMM-score: 17)
    MetabolismEnergy metabolismPentose phosphate pathwayfructose-6-phosphate aldolase (TIGR00875; EC 4.1.2.-; HMM-score: 14.3)
    ubiquitin-activating enzyme E1 (TIGR01408; HMM-score: 11.5)
  • TheSEED:  
    CarbohydratesFermentationFermentations: Lactate Alcohol dehydrogenase (EC 1.1.1.1) 
    FermentationFermentations: Mixed acid Alcohol dehydrogenase (EC 1.1.1.1) 
    Fatty Acids, Lipids, and IsoprenoidsPhospholipidsGlycerolipid and Glycerophospholipid Metabolism in Bacteria Alcohol dehydrogenase (EC 1.1.1.1) 
  • PFAM:
    NADP_Rossmann (CL0063) ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 103)
    GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 100)
    NADP_Rossmann (CL0063) ADH_zinc_N_2; Zinc-binding dehydrogenase (PF13602; HMM-score: 37.6)
    AlaDh_PNT_C; Alanine dehydrogenase/PNT, C-terminal domain (PF01262; HMM-score: 15.2)
    2-Hacid_dh_C; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826; HMM-score: 14.7)
    no clan definedBKACE; beta-keto acid cleavage enzyme (PF05853; HMM-score: 14.1)
    NADP_Rossmann (CL0063) Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 13.4)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 13.2)
    GroES (CL0296) ADH_N_2; N-terminal domain of oxidoreductase (PF16884; HMM-score: 12.6)
    no clan definedNADH_4Fe-4S; NADH-ubiquinone oxidoreductase-F iron-sulfur binding region (PF10589; HMM-score: 9.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0944(pdhB)pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2046(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA1245(sucA)2-oxoglutarate dehydrogenase E1  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0342hypothetical protein  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)
    SA0802hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 14
    • Cmax: 0.119
    • Cmax_pos: 47
    • Smax: 0.207
    • Smax_pos: 11
    • Smean: 0.159
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQYAKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVAKTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAAENKVTPKVQLRKLEEINDIFEEMEKGTITGRMVIKF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1851 (Rex*)
    Rex* (TF) important in Energy metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)