From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0707 [new locus tag: SA_RS04020 ]
  • pan locus tag?: SAUPAN002661000
  • symbol: SA0707
  • pan gene symbol?: saHPF
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0707 [new locus tag: SA_RS04020 ]
  • symbol: SA0707
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 805425..805997
  • length: 573
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTAGATTTGAAATTCATGGAGATAACCTCACTATCACAGATGCTATTCGCAACTAT
    ATTGAGGAAAAAATTGGTAAGTTGGAACGTTATTTTAATGACGTACCAAATGCAGTGGCG
    CATGTTAAAGTTAAAACTTATTCAAATTCAGCTACTAAAATTGAAGTAACAATTCCATTG
    AAAAATGTTACGTTAAGAGCTGAAGAGCGAAACGATGATTTATACGCAGGTATTGATTTA
    ATTAATAATAAACTTGAAAGACAAGTTCGAAAATATAAAACACGTATTAATCGTAAGAGC
    CGTGATCGAGGAGATCAAGAAGTGTTTGTTGCCGAATTACAAGAAATGCAAGAAACACAA
    GTTGATAATGACGCTTACGATGATAACGAGATAGAAATTATTCGTTCAAAAGAATTCAGC
    TTAAAACCAATGGATTCAGAAGAAGCGGTATTACAAATGAATCTATTAGGTCATGACTTC
    TTTGTATTCACAGACAGAGAAACTGATGGAACAAGTATCGTTTACCGACGTAAAGACGGT
    AAATATGGCTTGATTCAAACTAGTGAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0707 [new locus tag: SA_RS04020 ]
  • symbol: SA0707
  • description: hypothetical protein
  • length: 190
  • theoretical pI: 4.91383
  • theoretical MW: 22212.7
  • GRAVY: -0.763158

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisTranslation factorsribosomal subunit interface protein (TIGR00741; HMM-score: 101.8)
  • TheSEED:  
    Ribosome activity modulation Ribosome hibernation promoting factor Hpf 
  • PFAM:
    no clan definedRibosom_S30AE_C; Sigma 54 modulation/S30EA ribosomal protein C terminus (PF16321; HMM-score: 97)
    Ribosomal_S30AE; Sigma 54 modulation protein / S30EA ribosomal protein (PF02482; HMM-score: 92.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 68
    • Cmax: 0.115
    • Cmax_pos: 41
    • Smax: 0.115
    • Smax_pos: 65
    • Smean: 0.075
    • D: 0.092
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPLKNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQVDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTSEQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)