From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0734 [new locus tag: SA_RS04175 ]
  • pan locus tag?: SAUPAN002713000
  • symbol: SA0734
  • pan gene symbol?: est
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0734 [new locus tag: SA_RS04175 ]
  • symbol: SA0734
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 840074..840814
  • length: 741
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCAGATAAAATTACCAAAACCTTTCTTTTTTGAAGAAGGCAAACGTGCCGTGTTATTA
    TTACATGGATTTACAGGCAATTCGTCTGATGTACGTCAATTAGGTCGATTTTTACAAAAA
    AAGGGATATACTTCGTATGCACCACAATATGAAGGTCACGCGGCACCACCAGAGGAAATA
    CTGAAATCTAGTCCTTTCGTTTGGTTTAAAGATGCGTTAGATGGTTATGATTATCTTGTT
    GAACAAGGTTATGATGAAATTGTTGTTGCTGGTCTATCATTAGGTGGGGATTTTGCTTTA
    AAATTAAGCTTAAATAGAGATGTAAAGGGTATTGTAACGATGTGTGCACCAATGGGTGGC
    AAAACTGAAGGTGCCATTTATGAAGGCTTTTTAGAGTATGCACGTAATTTTAAAAAGTAT
    GAAGGTAAAAATCAAGAGACTATTGATAATGAAATGGATCATTTTAAACCAACTGAAACT
    TTAAAAGAACTAAGTGAAGCATTAGATACGATTAAAGATCAAGTTGATGAGGTATTTGAC
    CCAATTTTAGTGATTCAAGTAGAAAACGACAATATGATTGATCCACAATCCGCAAATTAT
    ATATATGACCATGTAGATTCTGATGACAAAGACATCAAGTGGTATAGTCAATCAGGACAT
    GTTATTACGATTGATAAAGAAAAAGAACAAGTATTTGAAGATATTTATCAATTTTTAGAG
    TCATTAGACTGGTCAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0734 [new locus tag: SA_RS04175 ]
  • symbol: SA0734
  • description: hypothetical protein
  • length: 246
  • theoretical pI: 4.28248
  • theoretical MW: 28155.3
  • GRAVY: -0.506911

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Plasmodium subtelomeric family (TIGR01607; HMM-score: 26.9)
    MetabolismFatty acid and phospholipid metabolismBiosynthesispoly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 22.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 22.4)
    MetabolismEnergy metabolismOther3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 18.9)
  • TheSEED:  
    Carboxylesterase (EC 3.1.1.1) 
  • PFAM:
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 65.8)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 34.2)
    DLH; Dienelactone hydrolase family (PF01738; HMM-score: 31)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 26.6)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 24.7)
    BAAT_C; BAAT / Acyl-CoA thioester hydrolase C terminal (PF08840; HMM-score: 19.1)
    Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 16.4)
    FSH1; Serine hydrolase (FSH1) (PF03959; HMM-score: 14.8)
    LisH (CL0561) LisH; LisH (PF08513; HMM-score: 14.4)
    AB_hydrolase (CL0028) DUF2048; Abhydrolase domain containing 18 (PF09752; HMM-score: 13.9)
    no clan definedDUF4611; Domain of unknown function (DUF4611) (PF15387; HMM-score: 13.8)
    AB_hydrolase (CL0028) Chlorophyllase2; Chlorophyllase enzyme (PF12740; HMM-score: 13.6)
    Chlorophyllase; Chlorophyllase (PF07224; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.173
    • Ymax_pos: 15
    • Cmax: 0.106
    • Cmax_pos: 38
    • Smax: 0.398
    • Smax_pos: 5
    • Smean: 0.288
    • D: 0.218
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEILKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGGKTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFDPILVIQVENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLESLDWSE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]