From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0753 [new locus tag: SA_RS04295 ]
  • pan locus tag?: SAUPAN002812000
  • symbol: SA0753
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0753 [new locus tag: SA_RS04295 ]
  • symbol: SA0753
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 861025..861642
  • length: 618
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGTAACCGCAATTATTCATGGATTTATCTTAGCGATTGGTCTAATTTTACCTTTAGGT
    GCACAAAATGTATTTATTTTTAACCAAGGAGCTAATCAACCAAAATATAGATATGTATTG
    CCTGCAATAATTACAGCCGGGTTGTCAGACAGCTTACTTATTATTATTGCAGTGGTAGGA
    GTATCTATCATTATTATGTCTTTACCTGTACTTCAAGCAATTATTTATATAGTTGGTTTA
    ATTTTCTTGATGTATATGGCTTGGACCATTTGGCATGATAAACCCTCAACAGATGGAGAA
    GCTCAAATTATATCTCCAATGAAACAAGTAAGTTTTGCTTTATCAGTTTCATTACTCAAT
    CCACATGCTATTTTAGATACAATTGGTGTAATTGGTAGTAGTGCTGCATTATATAGTGGC
    AGCAATAAAATTGCGTTTACAATCGCTTGTATTAGCGTTTCATGGTTATGGTTCTTTTTA
    CTCGCAATTTTAGGAAAAATGGTTGGATCAATTGATAAAACTGGAAAATTATTAACAATA
    ATCAATAAAATATCAAGCATAATAATTATTATTGTTGCTCTAATGATATTACAAAAACTT
    ATTCAATTATTATTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0753 [new locus tag: SA_RS04295 ]
  • symbol: SA0753
  • description: hypothetical protein
  • length: 205
  • theoretical pI: 9.71156
  • theoretical MW: 22163.8
  • GRAVY: 1.20976

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesL-lysine exporter (TIGR00948; HMM-score: 152.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and amineshomoserine/Threonine efflux protein (TIGR00949; HMM-score: 35)
  • TheSEED:  
    Putative amino-acid transporter YisU, LysE family 
  • PFAM:
    LysE (CL0292) LysE; LysE type translocator (PF01810; HMM-score: 94.5)
    no clan definedCAAD; CAAD domains of cyanobacterial aminoacyl-tRNA synthetase (PF14159; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.256
    • Ymax_pos: 27
    • Cmax: 0.255
    • Cmax_pos: 27
    • Smax: 0.41
    • Smax_pos: 21
    • Smean: 0.23
    • D: 0.246
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVGVSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGEAQIISPMKQVSFALSVSLLNPHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTIINKISSIIIIIVALMILQKLIQLLF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]