Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0760 [new locus tag: SA_RS04330 ]
  • pan locus tag?: SAUPAN002821000
  • symbol: SA0760
  • pan gene symbol?: gcvH
  • synonym:
  • product: glycine cleavage system protein H

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0760 [new locus tag: SA_RS04330 ]
  • symbol: SA0760
  • product: glycine cleavage system protein H
  • replicon: chromosome
  • strand: +
  • coordinates: 865727..866107
  • length: 381
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    TTGGCAGTACCAAATGAATTGAAATATTCAAAAGAGCATGAATGGGTTAAAGTTGAAGGT
    AATGTAGCAACAATTGGAATCACAGAATACGCACAAAGCGAGTTAGGTGATATTGTTTTC
    GTTGAATTACCAGAAACAGATGATGAAATTAATGAAGGGGATACGTTTGGTAGCGTAGAA
    TCAGTTAAAACTGTATCAGAATTATATGCACCAATCTCTGGTAAAGTAGTTGAAGTCAAC
    GAAGAACTAGAAGATAGTCCCGAATTTGTAAATGAATCTCCATACGAAAAAGCATGGATG
    GTAAAAGTAGAAATTAGTGATGAAAGTCAGCTTGAAGCTTTATTAACAGCTGAAAAATAT
    TCAGAAATGATTGGTGAATAA
    60
    120
    180
    240
    300
    360
    381

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0760 [new locus tag: SA_RS04330 ]
  • symbol: SA0760
  • description: glycine cleavage system protein H
  • length: 126
  • theoretical pI: 3.70004
  • theoretical MW: 14080.4
  • GRAVY: -0.380159

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 185.4)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 70.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 15.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 11)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineGlycine and Serine Utilization Glycine cleavage system H protein 
    Alanine, serine, and glycineGlycine cleavage system Glycine cleavage system H protein 
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 167.5)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 16.7)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 16.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: (R)-lipoate
  • effectors:
  • protein partners:
    SA2427(arcB)ornithine carbamoyltransferase  [1] (data from MRSA252)
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA1367(gcvT)glycine cleavage system aminomethyltransferase T  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0944(pdhB)pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2035(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1502(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA1503(rpmI)50S ribosomal protein L35  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA0504(rpsG)30S ribosomal protein S7  [1] (data from MRSA252)
    SA2025(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    SA2043(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    SA1245(sucA)2-oxoglutarate dehydrogenase E1  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0873hypothetical protein  [1] (data from MRSA252)
    SA1365glycine dehydrogenase subunit 2  [1] (data from MRSA252)
    SA1366glycine dehydrogenase subunit 1  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 11
    • Cmax: 0.127
    • Cmax_pos: 32
    • Smax: 0.163
    • Smax_pos: 6
    • Smean: 0.144
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAVPNELKYSKEHEWVKVEGNVATIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVESVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQLEALLTAEKYSEMIGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]