From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0790 [new locus tag: SA_RS04510 ]
  • pan locus tag?: SAUPAN003027000
  • symbol: SA0790
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0790 [new locus tag: SA_RS04510 ]
  • symbol: SA0790
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 896097..896876
  • length: 780
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAACAGTATAAAGCGTATTTAATCGATTTAGATGGCACAATGTATATGGGAACAGAT
    GAGATTGATGGAGCAAAACAATTCATCGATTATTTAAATGTAAAAGGCATTCCTCATTTA
    TACGTAACTAATAATTCAACAAAAACACCTGAGCAAGTAACTGAAAAATTACGTGAAATG
    CACATTGATGCTAAACCAGAAGAGGTTGTAACGTCAGCGTTAGCCACTGCTGATTATATT
    TCAGAACAATCACCAGGAGCATCAGTATATATGTTAGGTGGGAGTGGTTTAAATACTGCG
    TTAACCGAAGCGGGACTTGTCATTAAAAATGACGAGCATGTTGATTATGTAGTTATTGGA
    CTTGACGAACAAGTTACATATGAAAAGCTTGCGATTGCAACGTTAGGTGTAAGAAATGGT
    GCAACATTTATTTCTACAAATCCTGATGTATCAATTCCTAAAGAGCGTGGTTTATTACCT
    GGTAATGGTGCTATTACAAGTGTTGTAAGTGTATCGACAGGTGTATCGCCACAATTTATT
    GGTAAACCAGAACCGATTATTATGGTTAAAGCATTAGAAATTTTAGGATTAGATAAATCC
    GAAGTTGCTATGGTAGGCGATTTGTACGATACCGATATTATGTCTGGTATTAACGTAGGT
    ATGGATACGATTCATGTACAAACAGGTGTATCTACGTTAGAAGATGTGCAAAATAAAAAT
    GTGCCACCAACGTATTCTTTTAAAGATTTAAATGAAGCAATAGCTGAATTAGAAAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0790 [new locus tag: SA_RS04510 ]
  • symbol: SA0790
  • description: hypothetical protein
  • length: 259
  • theoretical pI: 4.22967
  • theoretical MW: 27945.5
  • GRAVY: -0.0791506

Function[edit source | edit]

  • reaction:
    EC 3.1.3.-?  ExPASy
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 328.9)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 145.3)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIA (TIGR01460; HMM-score: 133)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 75.7)
    HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 59.6)
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 40.9)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 36.5)
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 31.4)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 27.2)
    HAD hydrolase, TIGR01456 family (TIGR01456; HMM-score: 21.6)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 21.5)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 19.8)
    AHBA synthesis associated protein (TIGR01454; HMM-score: 19.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotides5'-nucleotidase, lipoprotein e(P4) family (TIGR01533; HMM-score: 19.3)
    MetabolismTransport and binding proteinsOther5'-nucleotidase, lipoprotein e(P4) family (TIGR01533; HMM-score: 19.3)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 17.4)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 16.5)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 15.9)
    MetabolismEnergy metabolismSugarsphosphoglycolate phosphatase, bacterial (TIGR01449; EC 3.1.3.18; HMM-score: 15)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 14.2)
    HAD hydrolase, TIGR01548 family (TIGR01548; HMM-score: 12.4)
    Unknown functionGeneralmannosyl-3-phosphoglycerate phosphatase homolog (TIGR02463; EC 3.1.3.-; HMM-score: 12)
  • TheSEED:  
    Hypothetical NagD-like phosphatase 
  • PFAM:
    HAD (CL0137) Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 87.9)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 67)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 46.8)
    HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 42.8)
    Acid_phosphat_B; HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767; HMM-score: 11.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.106
    • Ymax_pos: 29
    • Cmax: 0.114
    • Cmax_pos: 25
    • Smax: 0.17
    • Smax_pos: 22
    • Smean: 0.083
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREMHIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIGLDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFIGKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKNVPPTYSFKDLNEAIAELEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]