From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0811 [new locus tag: SA_RS04620 ]
  • pan locus tag?: SAUPAN003051000
  • symbol: mnhC
  • pan gene symbol?: mnhC
  • synonym:
  • product: monovalent cation/H+ antiporter subunit C

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0811 [new locus tag: SA_RS04620 ]
  • symbol: mnhC
  • product: monovalent cation/H+ antiporter subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 914963..915304
  • length: 342
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    GTGGAAATTATTATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTT
    TTGTCTAAAAGTCTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAAC
    TTATTTTTAATAACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAAC
    GTAAAAAGCTATGTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCC
    TTTGCGACAACAGCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACA
    GATAACGTTGAGAGTATGAAAGGAGTTCCAGAAGATGATTGA
    60
    120
    180
    240
    300
    342

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0811 [new locus tag: SA_RS04620 ]
  • symbol: MnhC
  • description: monovalent cation/H+ antiporter subunit C
  • length: 113
  • theoretical pI: 5.61663
  • theoretical MW: 12292.6
  • GRAVY: 0.839823

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmulticomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 175.7)
  • TheSEED:  
    Membrane TransportUni- Sym- and AntiportersSodium Hydrogen Antiporter Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3) 
  • PFAM:
    no clan definedOxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 110.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.159
    • Ymax_pos: 39
    • Cmax: 0.145
    • Cmax_pos: 39
    • Smax: 0.258
    • Smax_pos: 25
    • Smean: 0.153
    • D: 0.157
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]