From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • pan locus tag?: SAUPAN003179000
  • symbol: SA0866
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • symbol: SA0866
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 979642..980496
  • length: 855
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAATTTAAGTATCATATATCACAACAAGAAACTGTTAAAGCTTTTTTAGCACGACAT
    GATTTTTCTAAGAAGACAGTGAGCGCCATTAAAAATAATGGCGCTTTAATTGTTAATGAT
    GAACCAGTCACAGTACGTAAGCAATTAATGCCAAATGATATATTAGAAATTCATTTACCG
    CGAGAAATACCGAGTGTTAATTTAATACCTTATGCTCGTAAGCTAGAAGTATTGTATGAA
    GATGCTTTTATCATCATAGTTACTAAACCAAACAATCAAAATTGTACGCCTTCGAGAGAA
    CATCCTCATGAAAGTTTAATCGAACAAGTACTATATCATTGTCAGGAACATGGTGAAAAT
    ATTAACCCACATATTGTTACGCGTCTAGATCGTAATACAACTGGTATTGTGATATTCGCT
    AAATATGGACATATCCATCATTTATTTTCTAAAGTAAACTTGAAAAAAATATATACTTGC
    CTTGTATATGGCAAAACCCATACATCTGGTATTATTGAAGCTAATATTAGACGGTCAAAG
    GATAGTATTATAACTAGAGAAGTTGCCTCGGATGGTAAATACGCTAAAACATCTTATGAA
    GTAATAAATCAGAATGATAAATACAGTTTATGCAAAGTTCATTTGCATACGGGACGTACA
    CATCAAATTCGTGTACATTTTCAACATATTGGGCATCCAATTGTGGGAGATTCTTTGTAT
    GATGGTTTTCATGACAAAATTCATGGTCAAGTACTGCAATGTACGCAAATATATTTTGTT
    CATCCAATCAATAAGAACAATATTTATATTACAATTGATTATAAGCAATTACTTAAATTA
    TTCAATCAACTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    855

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • symbol: SA0866
  • description: hypothetical protein
  • length: 284
  • theoretical pI: 9.46148
  • theoretical MW: 32899.6
  • GRAVY: -0.377465

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase, RluA family (TIGR00005; EC 5.4.99.-; HMM-score: 182.2)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase Rlu family protein, TIGR01621 (TIGR01621; EC 5.4.99.-; HMM-score: 76)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase (TIGR00093; EC 5.4.99.-; HMM-score: 31.8)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type 
    CBSS-222523.1.peg.1311 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type 
  • PFAM:
    PseudoU_synth (CL0649) PseudoU_synth_2; RNA pseudouridylate synthase (PF00849; HMM-score: 88.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 25
    • Cmax: 0.125
    • Cmax_pos: 30
    • Smax: 0.322
    • Smax_pos: 15
    • Smean: 0.186
    • D: 0.163
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFKYHISQQETVKAFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMPNDILEIHLPREIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGENINPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSKDSIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLYDGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]