From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0924 [new locus tag: SA_RS05235 ]
  • pan locus tag?: SAUPAN003285000
  • symbol: purN
  • pan gene symbol?: purN
  • synonym:
  • product: phosphoribosylglycinamide formyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0924 [new locus tag: SA_RS05235 ]
  • symbol: purN
  • product: phosphoribosylglycinamide formyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1049510..1050076
  • length: 567
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGTTAAAATTGCGATTTTTGCATCAGGTTCAGGAAGTAACTTTGAAAATATAGTTGAG
    CATGTTGAATCAGGAAAACTTGAAAATATTGAAGTTACGGCGCTATATACGGATCATCAA
    AATGCGTTTTGTATAGATAGAGCAAAAAAGCACGATATTCCTGTTTATATTAATGAACCA
    AAACAATTTGATTCAAAAGCAGCGTATGAACAACATTTAGTAACATTATTAAATAAAGAT
    AAGGTAGAGTGGATTATTTTAGCTGGCTACATGCGTCTAATTGGTCCAGATTTATTAGCT
    TCATTTGAAGGTAAAATATTGAATATACATCCATCTCTATTGCCGAAATATAAGGGGATT
    GACGCAATAGGCCAAGCATATCATAGTGGCGATACTATTACTGGTTCGACAGTACATTAT
    GTTGATTGTGGTATGGATACGGGAGAAATTATTGAACAGAGACAATGTGATATTAGACCG
    GACGATTCAAAAGAACAATTAGAAGAGAAAGTAAAAAAATTGGAATATGAGTTATATCCA
    AGTGTTATTGCTAAAATTGTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0924 [new locus tag: SA_RS05235 ]
  • symbol: PurN
  • description: phosphoribosylglycinamide formyltransferase
  • length: 188
  • theoretical pI: 5.31194
  • theoretical MW: 21166
  • GRAVY: -0.283511

Function[edit source | edit]

  • reaction:
    EC 2.1.2.2?  ExPASy
    Phosphoribosylglycinamide formyltransferase10-formyltetrahydrofolate + N1-(5-phospho-D-ribosyl)glycinamide = tetrahydrofolate + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylglycinamide formyltransferase (TIGR00639; EC 2.1.2.2; HMM-score: 211.9)
    and 3 more
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisformyltetrahydrofolate deformylase (TIGR00655; EC 3.5.1.10; HMM-score: 100.8)
    Genetic information processingProtein synthesistRNA aminoacylationmethionyl-tRNA formyltransferase (TIGR00460; EC 2.1.2.9; HMM-score: 89.6)
    phosphoglycerol geranylgeranyltransferase, putative (TIGR04147; EC 2.5.1.41; HMM-score: 13.2)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesDe Novo Purine Biosynthesis Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 
    and 1 more
    Potassium metabolismPotassium metabolism - no subcategoryGlutathione-regulated potassium-efflux system and associated functions Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 
  • PFAM:
    no clan definedFormyl_trans_N; Formyl transferase (PF00551; HMM-score: 187.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.166
    • Ymax_pos: 22
    • Cmax: 0.14
    • Cmax_pos: 22
    • Smax: 0.262
    • Smax_pos: 18
    • Smean: 0.189
    • D: 0.175
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVKIAIFASGSGSNFENIVEHVESGKLENIEVTALYTDHQNAFCIDRAKKHDIPVYINEPKQFDSKAAYEQHLVTLLNKDKVEWIILAGYMRLIGPDLLASFEGKILNIHPSLLPKYKGIDAIGQAYHSGDTITGSTVHYVDCGMDTGEIIEQRQCDIRPDDSKEQLEEKVKKLEYELYPSVIAKIVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: PurR regulon
    PurR(TF)important in Purine metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)