From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1087 [new locus tag: SA_RS06160 ]
  • pan locus tag?: SAUPAN003536000
  • symbol: rnhB
  • pan gene symbol?: rnhB
  • synonym:
  • product: ribonuclease HII

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1087 [new locus tag: SA_RS06160 ]
  • symbol: rnhB
  • product: ribonuclease HII
  • replicon: chromosome
  • strand: +
  • coordinates: 1230383..1231150
  • length: 768
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACGCTAACAATTAAAGAAGTTACGCAGTTGATTAATGCGGTTAATACAATAGAAGAA
    TTAGAAAATCATGAATGCTTTTTAGATGAGCGAAAAGGTGTTCAAAATGCCATAGCTAGG
    CGCAGAAAAGCGTTAGAAAAAGAACAAGCTTTAAAAGAAAAGTATGTTGAAATGACTTAC
    TTTGAAAATGAAATATTAAAAGAGCATCCTAATGCTATTATTTGTGGGATTGATGAAGTT
    GGAAGAGGACCTTTAGCAGGTCCAGTCGTTGCATGCGCAACAATTTTAAATTCAAATCAC
    AATTATTTGGGCCTTGATGACTCGAAAAAAGTACCTATTACGAAACGTCTAGAATTAAAT
    GAAGCACTAAAAAATGAAGTTACTGCTTTTGCATATGGTATCGCGACAGCTGAAGAAATA
    GATGAATTTAATATTTATAAAGCTACTCAAATCGCCATGCAGCGAGCTATTGATGGATTA
    TCAGTACAACCAACGCATTTATTGATAGACGCGATGACGCTTGATAATGCACTGCCTCAA
    GTATCTTTAATCAAGGGTGATGCAAGAAGTGTGTCCATTGCAGCTGCAAGTATCATGGCG
    AAGGTTTTTCGTGATGATTATATGACACAGTTATCTAAAGATTATCCTGAATACGGTTTT
    GAAAAAAACGCGGGTTATGGTACCAAACAACATTTACTAGCAATCGATGATATTGGCATT
    ATGAAAGAGCATAGAAAAAGCTTTGAACCTATAAAATCGTTACTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    768

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1087 [new locus tag: SA_RS06160 ]
  • symbol: RnhB
  • description: ribonuclease HII
  • length: 255
  • theoretical pI: 5.22942
  • theoretical MW: 28526.5
  • GRAVY: -0.246667

Function[edit source | edit]

  • reaction:
    EC 3.1.26.4?  ExPASy
    Ribonuclease HEndonucleolytic cleavage to 5'-phosphomonoester
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairribonuclease HII (TIGR00729; EC 3.1.26.4; HMM-score: 74.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairribonuclease HIII (TIGR00716; EC 3.1.26.4; HMM-score: 24.8)
  • TheSEED:  
    RNA MetabolismRNA processing and modificationRibonuclease H Ribonuclease HII (EC 3.1.26.4) 
    Conserved gene cluster associated with Met-tRNA formyltransferase Ribonuclease HII (EC 3.1.26.4) 
  • PFAM:
    RNase_H (CL0219) RNase_HII; Ribonuclease HII (PF01351; HMM-score: 120)
    no clan definedDUF3983; Protein of unknown function (DUF3983) (PF13137; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, Mn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.139
    • Ymax_pos: 22
    • Cmax: 0.113
    • Cmax_pos: 15
    • Smax: 0.211
    • Smax_pos: 20
    • Smean: 0.153
    • D: 0.145
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTYFENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPITKRLELNEALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQVSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGIMKEHRKSFEPIKSLL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]