From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1197 [new locus tag: SA_RS06810 ]
  • pan locus tag?: SAUPAN003758000
  • symbol: tyrA
  • pan gene symbol?: tyrA
  • synonym:
  • product: prephenate dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1197 [new locus tag: SA_RS06810 ]
  • symbol: tyrA
  • product: prephenate dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 1369786..1370877
  • length: 1092
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGACAACAGTTTTATTTGTTGGACTTGGATTAATTGGTGGAAGTCTTGCTAGCAATATA
    AAATACCATAACCCTAATACTAATATTATTGCATACGATGCAGATACTTCTCAGTTAGAT
    AAAGCTAAATCAATCGGCATTATTAATGAAAAATGTTTAAATTATAGTGAAGCTATTAAA
    AAAGCCGATGTAATTATTTATGCAACACCTGTTGCTATCACAAATAAATATCTTAGCGAG
    CTTATAGATATGCCAACTAAACCTGGTGTTATTGTTTCTGATACTGGTAGTACTAAAGCA
    ATGATACAGCAACACGAATCCAATTTATTAAAGCATAATATTCATTTAGTCAGTGGTCAT
    CCAATGGCTGGTAGTCATAAATCTGGTGTACTAAATGCTAAAAAGCACTTATTTGAAAAC
    GCTTATTATATTTTAGTCTATAATGAGCCAAGAAATGAGCAAGCAGCAAACACGTTAAAA
    GAACTGTTATCACCTACTCTTGCTAAATTTATTGTAACTACTGCTGAAGAACACGACTAC
    GTAACAAGCGTCGTAAGTCATTTACCTCATATCGTTGCATCTAGTTTAGTTCATGTTAGT
    CAAAAGAACGGTCAAGAACATCATTTAGTTAATAAACTTGCAGCTGGTGGTTTTCGTGAT
    ATCACTCGTATAGCTAGTAGTAATGCACAAATGTGGAAAGATATCACCTTGAGTAATAAA
    ACGTATATTTTAGAAATGATTCGACAGCTAAAAAGTCAGTTTCAAGATTTAGAAAGACTA
    ATTGAAAGCAATGATTCTGAAAAATTGTTATCATTTTTTGCCCAAGCTAAATCGTATCGC
    GACGCACTACCCGCTAAACAACTAGGTGGACTAAATACTGCGTATGATCTATATGTAGAT
    ATTCCGGATGAATCAGGTATGATAAGTAAAGTGACTTATATCATGAGTTTACATAACATA
    TCTATAAGCAACTTAAGAATCTTAGAAGTACGCGAAGATATATACGGTGCTTTAAAAATT
    AGTTTCAAAAATCCTACTGACCGAGAACGCGGTATGCAAGCATTGAGTGATTTTGATTGT
    TATATCCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1092

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1197 [new locus tag: SA_RS06810 ]
  • symbol: TyrA
  • description: prephenate dehydrogenase
  • length: 363
  • theoretical pI: 7.24059
  • theoretical MW: 40396.9
  • GRAVY: -0.181818

Function[edit source | edit]

  • reaction:
    EC 1.3.1.12?  ExPASy
    Prephenate dehydrogenasePrephenate + NAD+ = 4-hydroxyphenylpyruvate + CO2 + NADH
  • TIGRFAM:
    MetabolismEnergy metabolismPentose phosphate pathway6-phosphogluconate dehydrogenase (decarboxylating) (TIGR00872; EC 1.1.1.44; HMM-score: 22.6)
    MetabolismAmino acid biosynthesisSerine familyphosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 22.4)
    MetabolismAmino acid biosynthesisOtherpyrrolysine biosynthesis protein PylD (TIGR03911; HMM-score: 19.4)
    MetabolismAmino acid biosynthesisGlutamate familypyrroline-5-carboxylate reductase (TIGR00112; EC 1.5.1.2; HMM-score: 17)
    MetabolismEnergy metabolismAmino acids and amines3-hydroxyisobutyrate dehydrogenase (TIGR01692; EC 1.1.1.31; HMM-score: 15.4)
    MetabolismAmino acid biosynthesisPyruvate familyketol-acid reductoisomerase (TIGR00465; EC 1.1.1.86; HMM-score: 12.3)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesChorismate Synthesis Prephenate dehydrogenase (EC 1.3.1.12) 
    Aromatic amino acids and derivativesPhenylalanine and Tyrosine Branches from Chorismate Prephenate dehydrogenase (EC 1.3.1.12) 
  • PFAM:
    NADP_Rossmann (CL0063) PDH; Prephenate dehydrogenase (PF02153; HMM-score: 234.8)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 31.8)
    NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 29.8)
    ACT (CL0070) ACT; ACT domain (PF01842; HMM-score: 19)
    NADP_Rossmann (CL0063) 2-Hacid_dh_C; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826; HMM-score: 18.6)
    GFO_IDH_MocA; Oxidoreductase family, NAD-binding Rossmann fold (PF01408; HMM-score: 17.5)
    IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 17.2)
    no clan definedP4Ha_N; Prolyl 4-Hydroxylase alpha-subunit, N-terminal region (PF08336; HMM-score: 14.3)
    NADP_Rossmann (CL0063) Semialdhyde_dh; Semialdehyde dehydrogenase, NAD binding domain (PF01118; HMM-score: 13.5)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 13)
    NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 12.8)
    DapB_N; Dihydrodipicolinate reductase, N-terminus (PF01113; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.5
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.264
    • Ymax_pos: 23
    • Cmax: 0.197
    • Cmax_pos: 32
    • Smax: 0.568
    • Smax_pos: 15
    • Smean: 0.401
    • D: 0.317
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIKKADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHESNLLKHNIHLVSGHPMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDYVTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNKTYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVDIPDESGMISKVTYIMSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDCYIQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • tyrA no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]