From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1202 [new locus tag: SA_RS06835 ]
  • pan locus tag?: SAUPAN003765000
  • symbol: trpC
  • pan gene symbol?: trpC
  • synonym:
  • product: indole-3-glycerol phosphate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1202 [new locus tag: SA_RS06835 ]
  • symbol: trpC
  • product: indole-3-glycerol phosphate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1375540..1376322
  • length: 783
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACGATTTTAGCAGAAATTGTTAAATATAAACAGTCACTTTTACAAAATGGCTATTAT
    CAAGACAAACTTAATACCTTGAAAAGTGTGAAGATTCAGAATAAAAAATCTTTTATAAAC
    GCAATTGAGAAAGAACCAAAGCTAGCAATTATTGCAGAAATTAAATCGAAGAGTCCTACA
    GTTAATGACTTACCTGAACGAGATTTATCGCAACAAATCTCAGATTATGAAAAGTACGGT
    GCAAATGCCGTGTCCATTTTAACTGATGAAAAGTACTTTGGTGGTAGTTTTGAAAGATTA
    CAAGCATTGACAACAAAAACAACATTACCCGTATTATGCAAAGACTTTATTATAGACCCG
    CTTCAAATTGATGTTGCTAAACAAGCTGGTGCATCTATGATTTTATTGATCGTTAACATC
    TTATCGGATAAACAATTGAAAGATTTATATAACTACGCTATATCGCAAAATCTAGAAGTG
    TTAATTGAAGTACATGATCGCCATGAATTAGAACGTGCCTATAAGGTTAATGCTAAATTG
    ATTGGTGTAAATAACAGGGACTTAAAACGATTTGTCACAAATGTGGAACATACAAATACT
    ATTTTAGAAAATAAAAAACCCAATCATCATTATATTTCTGAAAGTGGTATTCACGATGCA
    TCTGATGTAAGAAAAATCTTGCATAGTGGTATCGATGGCTTACTAATAGGTGAGGCGCTT
    ATGCGTTGTGACAATCTATCTGAATTTTTACCACAACTGAAAATGCAAAAGGTGAAGTCA
    TGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1202 [new locus tag: SA_RS06835 ]
  • symbol: TrpC
  • description: indole-3-glycerol phosphate synthase
  • length: 260
  • theoretical pI: 8.58778
  • theoretical MW: 29508.9
  • GRAVY: -0.311538

Function[edit source | edit]

  • reaction:
    EC 4.1.1.48?  ExPASy
    Indole-3-glycerol-phosphate synthase1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate = 1-C-(3-indolyl)-glycerol 3-phosphate + CO2 + H2O
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine family1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 14.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotidesnicotinate-nucleotide diphosphorylase (carboxylating) (TIGR00078; EC 2.4.2.19; HMM-score: 12.5)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesTryptophan synthesis Indole-3-glycerol phosphate synthase (EC 4.1.1.48) 
  • PFAM:
    TIM_barrel (CL0036) IGPS; Indole-3-glycerol phosphate synthase (PF00218; HMM-score: 252.6)
    QRPTase_C; Quinolinate phosphoribosyl transferase, C-terminal domain (PF01729; HMM-score: 20.2)
    FMN_dh; FMN-dependent dehydrogenase (PF01070; HMM-score: 15.3)
    FAD-oxidase_C (CL0277) BBE; Berberine and berberine like (PF08031; HMM-score: 14)
    TIM_barrel (CL0036) His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 42
    • Cmax: 0.12
    • Cmax_pos: 42
    • Smax: 0.171
    • Smax_pos: 1
    • Smean: 0.104
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTILAEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPTVNDLPERDLSQQISDYEKYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDPLQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLIEVHDRHELERAYKVNAKLIGVNNRDLKRFVTNVEHTNTILENKKPNHHYISESGIHDASDVRKILHSGIDGLLIGEALMRCDNLSEFLPQLKMQKVKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: T-box(Trp), CodY
    T-box(Trp) (RNA) important in Amino acid metabolism  RegPrecise
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]