Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • pan locus tag?: SAUPAN003835000
  • symbol: SA1247
  • pan gene symbol?: arlR
  • synonym:
  • product: truncated ( response regulator ArlR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • symbol: SA1247
  • product: truncated ( response regulator ArlR
  • replicon: chromosome
  • strand: -
  • coordinates: 1423544..1423789
  • length: 246
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    GTGACGGTAAATGGCGCAGAAATTGAATTAACAAAAACAGAGTATGATTTACTATATCTT
    CTAGCTGAAAATAAAAACCATGTTATGCAACGGGAACAAATTTTAAATCATGTATGGGGT
    TATAATAGTGAAGTAGAAACAAATGTCGTAGATGTTTATATAAGATATTTACGAAACAAG
    TTAAAACCATACGATCGTGACAAAATGATTGAAACAGTTCGTGGCGTTGGGTATGTGATA
    CGATGA
    60
    120
    180
    240
    246

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1247 [new locus tag: SA_RS07075 ]
  • symbol: SA1247
  • description: truncated ( response regulator ArlR
  • length: 81
  • theoretical pI: 6.52603
  • theoretical MW: 9663
  • GRAVY: -0.490123

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 78.5)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 72)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 31.5)
  • TheSEED:  
    Putative response regulator ArlR 
  • PFAM:
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 100)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 39
    • Cmax: 0.112
    • Cmax_pos: 46
    • Smax: 0.168
    • Smax_pos: 30
    • Smean: 0.088
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1329 (Fur*)
    Fur* (TF) important in Iron homeostasis  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]