From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1418 [new locus tag: SA_RS08005 ]
  • pan locus tag?: SAUPAN004176000
  • symbol: SA1418
  • pan gene symbol?: comEA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1418 [new locus tag: SA_RS08005 ]
  • symbol: SA1418
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1625096..1625773
  • length: 678
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGTATCAATTTTTATTACGCTATAAAGATTTTTTAACTCAGTGGAAGTTATATATTATA
    AGTGCTGTTGTTTTAATTATGGTATTAATTGGTTTTATATTCTGGAGACAAGATGATTAT
    ACTTCAAGAAATTTTGAAAATAAAGATACTGCTCTGAAACAAAGCACTAGTGAAAATAAT
    AGTTTGTCCAAATTAGAAGATGTCCAGGTCAAAGATGGAGATAATTCCAAAAATAAAGGT
    CCTGTATATGTCGATGTAAAAGGTGCTGTTAAACATCCTAATGTTTATAAAATGACATCT
    AAGGATAGAGTAGTTGATTTACTTGATAAAGCACAATTATTGGATGATGCAGATGTAAGT
    CGAATTAATTTGTCTGAAAAATTAACAGATCAAAAAATGATTTTCATACCTCATAAAGGA
    CAAAAGAATGTTGAACCACAAATTGAAGTAAACAGTGTGCACGTAAAAAATGGGAACACA
    AATAATACTAAAGTAAATTTAAATACCGCATCTGTATCAGAATTGATGTCTGTTCCTGGA
    GTAGGGCAAGCTAAAGCTAATGCAATTGTTGAATATCGCAACCAACAAGGTGCATTTCAA
    GAAATTGACGATTTGAAAAAAGTAAAAGGTTTTGGAAGTAAAACTTTTGATAAACTGAAA
    TCTTATTTCACGATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    678

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1418 [new locus tag: SA_RS08005 ]
  • symbol: SA1418
  • description: hypothetical protein
  • length: 225
  • theoretical pI: 9.68419
  • theoretical MW: 25575
  • GRAVY: -0.479111

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDNA transformationcomEA protein (TIGR01259; HMM-score: 115.6)
    Cellular processesCellular processesDNA transformationcompetence protein ComEA helix-hairpin-helix repeat region (TIGR00426; HMM-score: 74.4)
    Unknown functionEnzymes of unknown specificityputative DNA modification/repair radical SAM protein (TIGR03916; HMM-score: 20.8)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 13.2)
    MetabolismTransport and binding proteinsNucleosides, purines and pyrimidinesnucleoside Transporter (TIGR00939; HMM-score: 13.2)
  • TheSEED:  
    DNA MetabolismDNA uptake, competenceGram Positive Competence Late competence protein ComEA, DNA receptor 
    DNA uptake, competenceLate competence Late competence protein ComEA, DNA receptor 
  • PFAM:
    HHH (CL0198) HHH_3; Helix-hairpin-helix motif (PF12836; HMM-score: 89.7)
    HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 46.1)
    HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 29.4)
    Ubiquitin (CL0072) SLBB; SLBB domain (PF10531; HMM-score: 27.7)
    HHH (CL0198) HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 21.7)
    HHH_6; Helix-hairpin-helix motif (PF14579; HMM-score: 21)
    T2SSK; Type II secretion system (T2SS), protein K (PF03934; HMM-score: 18.6)
    Aha1_BPI (CL0648) DUF1439; Protein of unknown function (DUF1439) (PF07273; HMM-score: 18.6)
    HHH (CL0198) HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 16)
    RNA_pol_A_CTD; Bacterial RNA polymerase, alpha chain C terminal domain (PF03118; HMM-score: 14.8)
    PsbU; Photosystem II 12 kDa extrinsic protein (PsbU) (PF06514; HMM-score: 13.8)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 42
    • Cmax: 0.113
    • Cmax_pos: 37
    • Smax: 0.449
    • Smax_pos: 33
    • Smean: 0.142
    • D: 0.153
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYQFLLRYKDFLTQWKLYIISAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTSENNSLSKLEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLDDADVSRINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHVKNGNTNNTKVNLNTASVSELMSVPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SA0492 (SigH*) [1]
    SigH* (sigma factor) controls competence and phage integrase genes
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
    A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
    Genes Cells: 2003, 8(8);699-712
    [PubMed:12875655] [WorldCat.org] (P p)

Relevant publications[edit source | edit]