From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1448 [new locus tag: SA_RS08160 ]
  • pan locus tag?: SAUPAN004218000
  • symbol: SA1448
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1448 [new locus tag: SA_RS08160 ]
  • symbol: SA1448
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1651966..1652634
  • length: 669
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
    CAAGCATTGTTCGGAAATATCGAAGAAGATCCTACAATTATTGAAAATTATATTAATGCT
    GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
    TTAACAATAGATCCGAAGAATGGCGTCGTATTTTATAATCTAGCAAATGTATATTATAAT
    CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
    CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
    GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
    TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
    AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
    TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
    ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
    GAGGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1448 [new locus tag: SA_RS08160 ]
  • symbol: SA1448
  • description: hypothetical protein
  • length: 222
  • theoretical pI: 4.37482
  • theoretical MW: 25718.1
  • GRAVY: -0.295946

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 73.5)
    putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 69)
    type III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 59.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesmitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 53.8)
    tol-pal system protein YbgF (TIGR02795; HMM-score: 32.7)
    putative peptide modification system cyclase (TIGR04510; HMM-score: 25.8)
    Unknown functionGeneralheme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 23.5)
    pentatricopeptide repeat domain (TIGR00756; HMM-score: 22.7)
    poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.4)
  • TheSEED:  
    TPR repeat-containing protein YrrB 
  • PFAM:
    TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 99.8)
    TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 99.3)
    TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.2)
    TPR_11; TPR repeat (PF13414; HMM-score: 87.5)
    TPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 80.5)
    TPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 65.1)
    TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 64.6)
    TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 61)
    TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 59.5)
    TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 52.6)
    ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 52.3)
    TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 47.5)
    TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 41.9)
    TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 36)
    TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.6)
    TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 28.4)
    TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 26.7)
    PPR; PPR repeat (PF01535; HMM-score: 25.5)
    TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 22.3)
    no clan definedMIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 19.8)
    TPR (CL0020) PPR_2; PPR repeat family (PF13041; HMM-score: 18.2)
    Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 17.4)
    TPR (CL0020) TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 16.8)
    NARP1; NMDA receptor-regulated protein 1 (PF12569; HMM-score: 16.1)
    TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 15.8)
    Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 13.7)
    no clan definedCbtA_toxin; CbtA_toxin of type IV toxin-antitoxin system (PF06755; HMM-score: 12.4)
    TPR (CL0020) Sel1; Sel1 repeat (PF08238; HMM-score: 10.2)
    Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 9.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.095
    • Ymax_pos: 30
    • Cmax: 0.111
    • Cmax_pos: 48
    • Smax: 0.117
    • Smax_pos: 52
    • Smean: 0.077
    • D: 0.088
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIDQQTIYQYIQNGKIEEALQALFGNIEEDPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFYNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]