From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • pan locus tag?: SAUPAN004228000
  • symbol: SA1453
  • pan gene symbol?: cymR
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • symbol: SA1453
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1657620..1658042
  • length: 423
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAATTTCTACTAAAGGGAGATATGGACTTACATTGATGATTTCTCTTGCTAAAAAA
    GAGGGGCAAGGATGTATATCATTAAAGTCAATTGCTGAAGAAAATAATTTGAGTGATTTA
    TATTTAGAACAGCTTGTAGGTCCTTTAAGAAATGCGGGGTTAATTCGAAGTGTACGCGGT
    GCTAAAGGTGGATACCAATTAAGAGTACCAGCGGAAGAAATCTCAGCAGGGGATATTATA
    AGACTGTTAGAAGGTCCAATTACATTTGTTGAAAGTATTGAATCAGAACCACCTGCGCAA
    AAACAACTATGGATTCGCATGAGAGATGCAGTGAGAGATGTTTTAGATAATACAACATTG
    AAATATTTAGCGGAATATGTAGATACAAGTGAAGATTTAGACGGATACATGTTTTATATT
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • symbol: SA1453
  • description: hypothetical protein
  • length: 140
  • theoretical pI: 4.79134
  • theoretical MW: 15642.9
  • GRAVY: -0.175

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 108.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
    Signal transductionRegulatory functionsDNA interactionsFeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
  • TheSEED:  
    RNA MetabolismTranscriptionRrf2 family transcriptional regulators Iron-sulfur cluster regulator IscR 
    Stress ResponseStress Response - no subcategoryFlavohaemoglobin Iron-sulfur cluster regulator IscR 
    Sulfur MetabolismOrganic sulfur assimilationAt5g37530 (CsdL protein family) Iron-sulfur cluster regulator IscR 
  • PFAM:
    HTH (CL0123) Rrf2; Transcriptional regulator (PF02082; HMM-score: 94)
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 17.8)
    MarR_2; MarR family (PF12802; HMM-score: 12.8)
    no clan definedPPO1_DWL; Polyphenol oxidase middle domain (PF12142; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.179
    • Ymax_pos: 29
    • Cmax: 0.12
    • Cmax_pos: 25
    • Smax: 0.537
    • Smax_pos: 2
    • Smean: 0.267
    • D: 0.213
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDTSEDLDGYMFYI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]