From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1619 [new locus tag: SA_RS09105 ]
  • pan locus tag?: SAUPAN004518000
  • symbol: SA1619
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1619 [new locus tag: SA_RS09105 ]
  • symbol: SA1619
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1853499..1854125
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAATTCAAAGCTATCGTTGCAATCACATTATCATTTTCACTATTAACTGCCTGCGGT
    GCTAATCAACATAAAGAAAATAATAGTAAATCAAATGACACTACTAAAAAGACGCAAGAA
    ACTGACAACACTACACAGTCAAATACAGAAAAGCAAATGACACCACAAGAAGCCGAAGAT
    ATCGTTCGAAACGATTACAAAGCAAGAGGTGCTAACGAAAATCAAACTTTAAATTATAAA
    ACAAATCTTGAACGGAGTAATGAACATGAATATTATGTTGAACATCTAGTCCGCGATGCA
    GTTGGCACACCTTTAAAACGTTGCGCTATTGTTAATCGACACAATGGTACGATTATTAAT
    ATTTTTGATGATATGTCAGAAAAAGATAAAGAAGAATTTGAAGCATTTAAAAAGAGAAGC
    CCTAAATACAACCCAGGTATGAGTGATCATGATAAAACAGATGGTGAGTCAGAAGACATT
    CAACATCATGACAATGATAATAACAAAGCCATTCAAAATGATACACCAGATCAAAAAGCC
    GTTGATAAAAACGATAAAAATGCTGTTAATAAAGAAGAAAAACATGATAACCATGCAAAA
    AATTCAGCAGAAACTAAAGTTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1619 [new locus tag: SA_RS09105 ]
  • symbol: SA1619
  • description: hypothetical protein
  • length: 208
  • theoretical pI: 6.24316
  • theoretical MW: 23751.7
  • GRAVY: -1.38894

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.4)
  • TheSEED:  
    Hypothetical protein SAV1801 
  • PFAM:
    no clan definedDUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 9.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: SLLTACG
  • SignalP: Signal peptide length 21 aa
    • Ymax: 0.425
    • Ymax_pos: 21
    • Cmax: 0.199
    • Cmax_pos: 25
    • Smax: 0.965
    • Smax_pos: 19
    • Smean: 0.93
    • D: 0.622
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFKAIVAITLSFSLLTACGANQHKENNSKSNDTTKKTQETDNTTQSNTEKQMTPQEAEDIVRNDYKARGANENQTLNYKTNLERSNEHEYYVEHLVRDAVGTPLKRCAIVNRHNGTIINIFDDMSEKDKEEFEAFKKRSPKYNPGMSDHDKTDGESEDIQHHDNDNNKAIQNDTPDQKAVDKNDKNAVNKEEKHDNHAKNSAETKVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]