From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1633 [new locus tag: SA_RS09190 ]
  • pan locus tag?: SAUPAN004570000
  • symbol: SA1633
  • pan gene symbol?:
  • synonym:
  • product: beta-lactamase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1633 [new locus tag: SA_RS09190 ]
  • symbol: SA1633
  • product: beta-lactamase
  • replicon: chromosome
  • strand: +
  • coordinates: 1866080..1866661
  • length: 582
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATACAAAATTTTTAGGTAAAACATTAGTAGCAAGTGCTTTAGTATTAACAACATTA
    GGAACAGGTTTACATTCTTCATACTTAGGATTAAATACAAATAAAGTTGTTAAAACAGCA
    AAAGCAGAAGAAAAAATGACAAATGGTCAATTGTGGAAAAAAGTTAAAGATTCATTAATT
    GATTCAAATATTATTAGTGGTAACGAAAATGAAGAGATTACAGTAACATATGTTAATAAA
    ACCGGATATTCTTCAAGTGTTTCTGCCTATGGTAATAATAATGACGATTTTTCAAGTACT
    CCAAGTAATTTTTCTAAACTTAAGGAAATTGACTTGAAAAAAGATAATGTACCGTCAGAT
    GATTTTAATACTACTGTTAGTGGTGAAGATAGTTGGAAAACACTTACATCTAAATTAAAG
    GAAAAAGGTTTGGTTACAGATGGACAAACAGTAACTATTCATTGTAATGATAAGTCTGAC
    AATACAAAATCATCTGTTTCAGGTAAAGTAGGAGCAGATCTGACAAGTGGCAATGGAACT
    ACATTCAAAAAACGCTTTATTGATAAAATCACAATTGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1633 [new locus tag: SA_RS09190 ]
  • symbol: SA1633
  • description: beta-lactamase
  • length: 193
  • theoretical pI: 8.94072
  • theoretical MW: 20876.1
  • GRAVY: -0.564249

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    DUF4888 protein 
  • PFAM:
    no clan definedDUF4888; Domain of unknown function (DUF4888) (PF16229; HMM-score: 133.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: TNKVVKTA
  • SignalP: no predicted signal peptide
    • Ymax: 0.361
    • Ymax_pos: 43
    • Cmax: 0.448
    • Cmax_pos: 43
    • Smax: 0.873
    • Smax_pos: 6
    • Smean: 0.539
    • D: 0.43
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTKFLGKTLVASALVLTTLGTGLHSSYLGLNTNKVVKTAKAEEKMTNGQLWKKVKDSLIDSNIISGNENEEITVTYVNKTGYSSSVSAYGNNNDDFSSTPSNFSKLKEIDLKKDNVPSDDFNTTVSGEDSWKTLTSKLKEKGLVTDGQTVTIHCNDKSDNTKSSVSGKVGADLTSGNGTTFKKRFIDKITID

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA1633 no polycistronic organisation predicted

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]