From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1671 [new locus tag: SA_RS09445 ]
  • pan locus tag?: SAUPAN004790000
  • symbol: SA1671
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1671 [new locus tag: SA_RS09445 ]
  • symbol: SA1671
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1908220..1908819
  • length: 600
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCAATGAACTTTAAAGTCTTTGACAATAGTCAACTTGTAGCAGAATATGCTGCTGAT
    ATTATTAGAAAGCAATTTAACAATAATCCTACTACAATTGCAGGTTTTCATTTAGATACA
    GATCAAGCGCCAGTTCTAGATGAATTAAAGAAAAATGTTGAAAAACATGCTGTTGATTTT
    AGCCAAATAAATATTTTAGATTATGACGATAAAAAATCATATTTCGAAGCGTTAGGTGTA
    CCAGCAGGTCAAGTTTATCCAATTGCTTATGAAAAAGATGCAATCGAATTAATCGCTGAT
    AAGATTAAAACTAAAGAAAATAAAGGGAAATTAACATTACAAGTTGTTTCTATCGATGAG
    CAAGGTAAGTTAAATGTTAGTATTCGTCAAGGACTAATGGAAGCAAGAGAAATTTTCTTA
    GTAGTGACAGGTGCTAATAAACGAGATGTAGTTGAAAAATTATATCAAGAAAATGGTAAA
    ACAAGCTTCGAACCAGCCGATTTAAAAGCACATAGAATGGTAAATGTTATTCTTGATAAA
    GAAGCGGCTGCAGGTTTACCTGAAGATGTTAAAGCTTACTTTACGTCACGCTTTGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1671 [new locus tag: SA_RS09445 ]
  • symbol: SA1671
  • description: hypothetical protein
  • length: 199
  • theoretical pI: 5.14542
  • theoretical MW: 22343.3
  • GRAVY: -0.331658

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismCentral intermediary metabolismAmino sugarsglucosamine-6-phosphate deaminase (TIGR00502; EC 3.5.99.6; HMM-score: 33.2)
    MetabolismEnergy metabolismPentose phosphate pathway6-phosphogluconolactonase (TIGR01198; EC 3.1.1.31; HMM-score: 19.1)
    type-F conjugative transfer system protein TraW (TIGR02743; HMM-score: 12.7)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 12.5)
  • TheSEED:  
    Hypothetical protein SAV1854 
  • PFAM:
    ISOCOT_Fold (CL0246) Glucosamine_iso; Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase (PF01182; HMM-score: 17)
    no clan definedDUF2103; Predicted metal-binding protein (DUF2103) (PF09876; HMM-score: 15.3)
    GlnB-like (CL0089) DUF3240; Protein of unknown function (DUF3240) (PF11582; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 19
    • Cmax: 0.134
    • Cmax_pos: 19
    • Smax: 0.258
    • Smax_pos: 15
    • Smean: 0.147
    • D: 0.148
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]