From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1750
  • pan locus tag?: SAUPAN005007000
  • symbol: SA1750
  • pan gene symbol?: truncated mapW
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1750
  • symbol: SA1750
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2003028..2003348
  • length: 321
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATCAAAAAAAAAATAAATAAATCTAATAATGTGAAATTCCCAGTAACAATAAATAAATTT
    GAAAACATAGTTTCAAATGAATTTGTGTTCTATAATGCAAGCAAAATTACAATTAATGAT
    TTAAGTATAAAACTTAAATCAGCAATGGCAAATGATCAAGGGATAACTAAACATGACATA
    GGACTTGCTGAACGCGCAGTGTATAAAGTGTATTTTAAAAATGGTTCGTCAAAATATGTA
    GACTTAAAAACTGAGTATAAAGATGAAAGAGTATTTAAAGCAACTGACATTAAAAAGGTA
    GATATTGAACTTAAATTCTAA
    60
    120
    180
    240
    300
    321

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1750
  • symbol: SA1750
  • description: hypothetical protein
  • length: 106
  • theoretical pI: 10.2408
  • theoretical MW: 12260.1
  • GRAVY: -0.49717

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionAdhesins in Staphylococcus Extracellular adherence protein of broad specificity Eap/Map 
  • PFAM:
    Ant-toxin_C (CL0386) MAP; MAP domain (PF03642; HMM-score: 112.5)
    no clan definedDUF768; Protein of unknown function (DUF768) (PF05589; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.209
    • Ymax_pos: 12
    • Cmax: 0.154
    • Cmax_pos: 51
    • Smax: 0.491
    • Smax_pos: 8
    • Smean: 0.438
    • D: 0.298
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927511 NCBI
  • RefSeq: NP_375044 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKKINKSNNVKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAMANDQGITKHDIGLAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIKKVDIELKF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SaeR
    SaeR (TF) important in Virulence  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]