From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1809 [new locus tag: SA_RS10395 ]
  • pan locus tag?: SAUPAN005186000
  • symbol: SA1809
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1809 [new locus tag: SA_RS10395 ]
  • symbol: SA1809
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2048178..2048420
  • length: 243
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGGAAAACTTTAATTATAATAACATAAAAAAACTTGTTCTTGAAAATGTTGATATAGAT
    AAAGTAAAAGAAGTATACAAAGATTATGAATTACTTAATTATACAATAAAAAACCAAACA
    CTTTACATGAACGATTATGAAGTTGCTAAAGTTTCTGAAAAACATCTAAACGAAAATATT
    AATAATCTAAGAGGCACGGTTAATCTAGACGAAAAATGTATTTTGTCACTAACCTATCTA
    TAA
    60
    120
    180
    240
    243

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1809 [new locus tag: SA_RS10395 ]
  • symbol: SA1809
  • description: hypothetical protein
  • length: 80
  • theoretical pI: 4.78191
  • theoretical MW: 9550.81
  • GRAVY: -0.5825

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    hypothetical protein 
  • PFAM:
    no clan definedDUF2340; Uncharacterized conserved protein (DUF2340) (PF10209; HMM-score: 14.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 57
    • Cmax: 0.106
    • Cmax_pos: 52
    • Smax: 0.229
    • Smax_pos: 48
    • Smean: 0.107
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MENFNYNNIKKLVLENVDIDKVKEVYKDYELLNYTIKNQTLYMNDYEVAKVSEKHLNENINNLRGTVNLDEKCILSLTYL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]