From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1854 [new locus tag: SA_RS10645 ]
  • pan locus tag?: SAUPAN005298000
  • symbol: SA1854
  • pan gene symbol?: gcp
  • synonym:
  • product: DNA-binding/iron metalloprotein/AP endonuclease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1854 [new locus tag: SA_RS10645 ]
  • symbol: SA1854
  • product: DNA-binding/iron metalloprotein/AP endonuclease
  • replicon: chromosome
  • strand: -
  • coordinates: 2094522..2095547
  • length: 1026
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGACTAAAGATATATTAATACTAGCTGTTGAAACAAGTTGTGATGAAACAAGCGTTAGT
    GTTATAAAAAATGGCAGAGATATTTTATCAAATACAGTTTTAAGTCAGATTGAAAGTCAT
    AAACGATTTGGCGGTGTCGTTCCCGAAGTGGCAAGTAGACATCACGTTGAAGGTATAACA
    ACAACAATAAACGAGGCTCTAGTGGATGCCGATGTATCAATGGAAGATATTGATGCCATA
    GCGGTTACAGAAGGCCCTGGACTAATTGGTGCGTTACTAATAGGTGTTAATGCAGCCAAA
    GCATTGGCATTTGCTTACGATAAGCCACTTATTCCTGTTCATCATATTGCAGGACATATA
    TATGCTAATCACATAGAAGAGCCATTAACATTCCCGCTAATTGCACTTATTGTTTCAGGT
    GGACATACTGAATTAGTTTATATGAAAGATCATTTATCATTTGAAGTCATTGGTGAAACA
    CGAGATGACGCAGTAGGTGAGGCTTATGATAAAGTGGCACGAACAATTGGTTTAAATTAT
    CCAGGTGGTCCACAAGTTGATCGGTTGGCTGCTGAAGGTGAAGATACTTATTCATTCCCT
    CGTGTTTGGTTGGATAAAGATAGTTATGATTTTAGTTTTAGTGGGTTGAAAAGTGCCGTG
    ATCAATCAACTTCACAATCAACGACAAAAAAATATTCCAATCATTGAAGCTAACGTAGCA
    ACGAGCTTTCAAAATAGTGTTGTAGAGGTGCTTACGTTTAAAGCTATTCAAGCTTGTAAA
    GAATATAGTGTTCAGCGATTAATTGTTGCTGGTGGCGTGGCGAGTAATAAAGGATTACGT
    CAATCTTTAGCGGATCAATGCAAAGTCAATGACATTCAATTAACTATCCCAAGTCCTAAA
    TTATGCACAGATAATGCTGCAATGATAGGCGTTGCCGGCCACTCTTTGTATCAGCAAGGT
    CGATTTGCTGATTTAGCATTAAATGGGCACAGCAATATAGATTTAGAAGAGTATTCTGCA
    GAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1026

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1854 [new locus tag: SA_RS10645 ]
  • symbol: SA1854
  • description: DNA-binding/iron metalloprotein/AP endonuclease
  • length: 341
  • theoretical pI: 4.7955
  • theoretical MW: 36862.4
  • GRAVY: 0.00351906

Function[edit source | edit]

  • reaction:
    EC 2.3.1.234?  ExPASy
    N6-L-threonylcarbamoyladenine synthaseL-threonylcarbamoyladenylate + adenine37 in tRNA = AMP + N6-L-threonylcarbamoyladenine37 in tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein TsaD (TIGR03723; HMM-score: 439.4)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesmetallohydrolase, glycoprotease/Kae1 family (TIGR00329; HMM-score: 365.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairuniversal archaeal protein Kae1 (TIGR03722; HMM-score: 221.8)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein YeaZ (TIGR03725; HMM-score: 57.7)
    Genetic information processingProtein fateProtein modification and repaircarbamoyltransferase HypF (TIGR00143; HMM-score: 16.4)
    putative CoA-substrate-specific enzyme activase (TIGR00241; HMM-score: 12.8)
  • TheSEED:  
    Bacterial RNA-metabolizing Zn-dependent hydrolases N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 
    Conserved gene cluster associated with Met-tRNA formyltransferase N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 
    YgjD and YeaZ N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 
    YrdC-YciO N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 
    YrdC-YciO-Sua5 and associated protein families N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 
  • PFAM:
    Actin_ATPase (CL0108) Peptidase_M22; Glycoprotease family (PF00814; HMM-score: 344.7)
    Carbam_trans_N; Carbamoyltransferase N-terminus (PF02543; HMM-score: 20.2)
    FGGY_C; FGGY family of carbohydrate kinases, C-terminal domain (PF02782; HMM-score: 15.4)
    NADP_Rossmann (CL0063) DUF166; Domain of unknown function (PF02593; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Fe2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 21
    • Cmax: 0.109
    • Cmax_pos: 36
    • Smax: 0.209
    • Smax_pos: 20
    • Smean: 0.153
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKDILILAVETSCDETSVSVIKNGRDILSNTVLSQIESHKRFGGVVPEVASRHHVEGITTTINEALVDADVSMEDIDAIAVTEGPGLIGALLIGVNAAKALAFAYDKPLIPVHHIAGHIYANHIEEPLTFPLIALIVSGGHTELVYMKDHLSFEVIGETRDDAVGEAYDKVARTIGLNYPGGPQVDRLAAEGEDTYSFPRVWLDKDSYDFSFSGLKSAVINQLHNQRQKNIPIIEANVATSFQNSVVEVLTFKAIQACKEYSVQRLIVAGGVASNKGLRQSLADQCKVNDIQLTIPSPKLCTDNAAMIGVAGHSLYQQGRFADLALNGHSNIDLEEYSAE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol. Microbiol.: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] (P p)

Relevant publications[edit source | edit]