From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • pan locus tag?: SAUPAN005300000
  • symbol: SA1856
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • symbol: SA1856
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2095977..2096666
  • length: 690
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACAAATTAAGGAGGCAATTATCCATGAATTCGCTGCTCATTGATACATCGAATCAA
    CCATTATCAGTAGCATTGATGCAAAACGATGAAGTTTTAGCTGAAATAACTACGGATTCT
    AAACAAAATCATTCAGTGCAATTAATGCCTGCGATTAGTCAGCTATTTGAGCAGAGCAAA
    ATAGCTAAACAGCAATTAGATGCGATTATTGTTGCTGAAGGTCCTGGTTCATATACTGGC
    TTACGTATCGGTGTTACTGTTGCTAAAACATTAGCGTATGCGTTAGATGTTAAATTATAT
    GGTGTTTCATCATTAAAGGCATTGGCAGCAACAATCGATCATACTGATAAATTATTGGTT
    CCTGTGTTTGATGCAAGACGACAAGCAGTTTATACAGGCATATTCCAGTGGCAAAATGGT
    CAATTAGTGACTATTTTAGAAGATCAATATATGTCGATAGAGGCATTGCGAGCTTTTTTA
    GAAGATTTAAACCAACCATTTATTTATATTGGGAAAGATACTATAAAATTACAAGATGAA
    TTACAAGGTGAAGTGATTGCGCAGCTACCAAATGCATCAGTCATGTATCAATTGATAGAT
    AAACCTACAGACGTACATACATTTACTCCTAAATACCATAAATTAGCTGAGGCGGAACGA
    AATTGGATCAACAGTCAAAAGAACAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    690

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1856 [new locus tag: SA_RS10655 ]
  • symbol: SA1856
  • description: hypothetical protein
  • length: 229
  • theoretical pI: 5.67604
  • theoretical MW: 25691.3
  • GRAVY: -0.165502

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein YeaZ (TIGR03725; HMM-score: 177.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein TsaD (TIGR03723; HMM-score: 44)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesmetallohydrolase, glycoprotease/Kae1 family (TIGR00329; HMM-score: 39.9)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairuniversal archaeal protein Kae1 (TIGR03722; HMM-score: 34.7)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryYgjD and YeaZ TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    Cell Wall and CapsuleCell Wall and Capsule - no subcategoryYjeE TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    RNA MetabolismRNA processing and modificationYrdC-YciO TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    RNA processing and modificationYrdC-YciO-Sua5 and associated protein families TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    Bacterial RNA-metabolizing Zn-dependent hydrolases TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
    Conserved gene cluster associated with Met-tRNA formyltransferase TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA 
  • PFAM:
    Actin_ATPase (CL0108) Peptidase_M22; Glycoprotease family (PF00814; HMM-score: 108.5)
    no clan definedDUF3126; Protein of unknown function (DUF3126) (PF11324; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.224
    • Ymax_pos: 35
    • Cmax: 0.178
    • Cmax_pos: 35
    • Smax: 0.554
    • Smax_pos: 12
    • Smean: 0.396
    • D: 0.292
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKLRRQLSMNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTIKLQDELQGEVIAQLPNASVMYQLIDKPTDVHTFTPKYHKLAEAERNWINSQKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]