Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1896 [new locus tag: SA_RS10910 ]
  • pan locus tag?: SAUPAN005375000
  • symbol: thiD
  • pan gene symbol?: thiD
  • synonym:
  • product: phosphomethylpyrimidine kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1896 [new locus tag: SA_RS10910 ]
  • symbol: thiD
  • product: phosphomethylpyrimidine kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 2148459..2149289
  • length: 831
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATTAAACCTAAAATAGCATTAACCATTGCAGGTACTGATCCAACAGGTGGTGCCGGC
    GTAATGGCTGATTTAAAATCATTTCATTCATGTGGTGTATATGGTATGGGCGTCGTTACA
    AGTATTGTTGCTCAAAATACATTGGGCGTACAACATATTCATAATTTAAATCATCAATGG
    GTAGATGAACAACTTGATAGTGTCTTCAATGATACCTTACCTCATGCTATTAAAACGGGG
    ATGATTGCTACAGCAGATACTATGGAAACGATTCGTCATTATTTAATGCAACATGAATCT
    ATTCCATATGTAATTGATCCTGTTATGTTGGCGAAAAGCGGTGATTCATTAATGGATAAT
    GACACAAAGCAAAACTTGCAGCATACGTTATTGCCATTAGCTGACGTAGTAACACCGAAT
    TTACCAGAAGCTGAAGAAATAACGGGACTAACCATTGATAGTGAAGAAAAAATTATGCAG
    GCTGGCCGCATCTTTATTAATGAGATTGGTAGTAAAGGTATCATCATTAAAGGCGGTCAT
    TCAAATGATACTGATATAGCAAAAGATTATTTATTTACTAACGAAGGTGTTCAAACATTT
    GAAAATGAACGATTTAAAACAAAACATACGCATGGAACAGGGTGTACATTTTCAGCAGTT
    ATAACGGCAGAACTTGCAAAAGGTAGACCATTATTTGAGGCTGTACACAAGGCTAAAAAG
    TTTATTTCAATGAGTATACAATATACACCTGAAATCGGCCGTGGTAGAGGACCAGTGAAT
    CATTTTGCATATTTAAAGAAAGAGGGATTAGACGATGAATTATCTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1896 [new locus tag: SA_RS10910 ]
  • symbol: ThiD
  • description: phosphomethylpyrimidine kinase
  • length: 276
  • theoretical pI: 6.18122
  • theoretical MW: 30242.3
  • GRAVY: -0.222464

Function[edit source | edit]

  • reaction:
    EC 2.7.4.7?  ExPASy
    Phosphomethylpyrimidine kinaseATP + 4-amino-2-methyl-5-(phosphomethyl)pyrimidine = ADP + 4-amino-2-methyl-5-(diphosphomethyl)pyrimidine
    EC 2.7.1.49?  ExPASy
    Hydroxymethylpyrimidine kinaseATP + 4-amino-5-hydroxymethyl-2-methylpyrimidine = ADP + 4-amino-2-methyl-5-(phosphomethyl)pyrimidine
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminehydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 311.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal kinase (TIGR00687; EC 2.7.1.35; HMM-score: 56)
    MetabolismEnergy metabolismSugarsribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 41)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 24.1)
    hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 21.5)
    1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 18.2)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCofactors, Vitamins, Prosthetic Groups, Pigments - no subcategoryThiamin biosynthesis Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7) 
    Thiamin biosynthesis Hydroxymethylpyrimidine kinase (EC 2.7.1.49) 
  • PFAM:
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 310)
    PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 45.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.212
    • Ymax_pos: 53
    • Cmax: 0.219
    • Cmax_pos: 24
    • Smax: 0.416
    • Smax_pos: 42
    • Smean: 0.224
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQWVDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDNDTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGIIIKGGHSNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKKFISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: TPP
    TPP (RNA) important in Thiamine biosynthesis  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)