From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1996
  • pan locus tag?: SAUPAN005591000
  • symbol: lacB
  • pan gene symbol?: lacB
  • synonym:
  • product: galactose-6-phosphate isomerase subunit LacB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1996
  • symbol: lacB
  • product: galactose-6-phosphate isomerase subunit LacB
  • replicon: chromosome
  • strand: -
  • coordinates: 2268067..2268582
  • length: 516
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAGATTGCATTAGGATGCGACCATATTGTTACAGATACAAAAATGCGTGTATCTGAA
    TTTTTAAAATCAAAAGGACATGAAGTCATTGACGTAGGAACATACGATTTTACAAGAACA
    CATTATCCAATTTTTGGTAAAAAAGTTGGCGAACAAGTTGTTAGCGGTAATGCAGACTTA
    GGTGTTTGTATTTGTGGAACAGGTGTTGGTATTAACAATGCTGTAAATAAAGTACCTGGC
    GTTCGTTCAGCACTAGTACGTGATATGACATCAGCGTTATATGCTAAAGAAGAATTAAAT
    GCGAACGTTATTGGCTTTGGTGGACGTATTATAGGTGAGTTATTAATGTGCGATATTATC
    GATGCATTTATTAACGCTGAATATAAAGCAACTGAAGAGAACAAAAAATTAATCGCTAAA
    ATTAAACATTTAGAAACAAGCAATGCAGATCAAGCTGATCCACATTTCTTTGATGAATTC
    TTAGAAAAATGGGACAGAGGCGAATACCACGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    516

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1996
  • symbol: LacB
  • description: galactose-6-phosphate isomerase subunit LacB
  • length: 171
  • theoretical pI: 5.59496
  • theoretical MW: 18924.5
  • GRAVY: -0.192982

Function[edit source | edit]

  • reaction:
    EC 5.3.1.26?  ExPASy
    Galactose-6-phosphate isomeraseD-galactose 6-phosphate = D-tagatose 6-phosphate
  • TIGRFAM:
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesgalactose-6-phosphate isomerase, LacB subunit (TIGR01119; EC 5.3.1.26; HMM-score: 372.2)
    sugar-phosphate isomerase, RpiB/LacA/LacB family (TIGR00689; EC 5.3.1.-; HMM-score: 125.5)
    MetabolismEnergy metabolismPentose phosphate pathwayribose 5-phosphate isomerase B (TIGR01120; EC 5.3.1.6; HMM-score: 118.3)
    ribose 5-phosphate isomerase (TIGR02133; EC 5.3.1.6; HMM-score: 105.1)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesgalactose-6-phosphate isomerase, LacA subunit (TIGR01118; EC 5.3.1.26; HMM-score: 48.8)
    Hypothetical proteinsConservedconserved hypothetical protein EF_0830/AHA_3911 (TIGR03577; HMM-score: 13.5)
  • TheSEED:  
    CarbohydratesDi- and oligosaccharidesLactose and Galactose Uptake and Utilization Galactose-6-phosphate isomerase, LacB subunit (EC 5.3.1.26) 
  • PFAM:
    no clan definedLacAB_rpiB; Ribose/Galactose Isomerase (PF02502; HMM-score: 142.4)
    Gly_rich_SFCGS; Glycine-rich SFCGS (PF14272; HMM-score: 16.5)
    Succ_CoA_synth (CL0506) Ligase_CoA; CoA-ligase (PF00549; HMM-score: 13.2)
    no clan definedKu_PK_bind; Ku C terminal domain like (PF08785; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 18
    • Cmax: 0.108
    • Cmax_pos: 27
    • Smax: 0.186
    • Smax_pos: 10
    • Smean: 0.14
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: LacR
    LacR (TF) important in Lactose utilization  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]