From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2089 [new locus tag: SA_RS12000 ]
  • pan locus tag?: SAUPAN005760000
  • symbol: sarR
  • pan gene symbol?: sarR
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2089 [new locus tag: SA_RS12000 ]
  • symbol: sarR
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2348097..2348444
  • length: 348
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAGTAAAATTAATGACATTAATGATTTAGTCAACGCAACATTTCAAGTTAAGAAGTTT
    TTCAGAGATACAAAAAAGAAGTTCAATTTGAACTATGAAGAAATTTATATTTTAAATCAT
    ATTTTAAGAAGTGAGTCTAACGAAATCTCATCTAAAGAGATTGCTAAGTGCTCAGAGTTC
    AAACCTTACTATTTAACTAAAGCTTTACAAAAGCTAAAAGATTTAAAATTGTTATCAAAG
    AAAAGAAGTTTACAAGACGAAAGAACAGTTATTGTTTATGTTACAGATACACAAAAAGCA
    AATATTCAAAAACTGATTTCAGAATTAGAAGAATACATTAAAAATTAA
    60
    120
    180
    240
    300
    348

Protein[edit source | edit]

Protein Data Bank: 1HSJ

General[edit source | edit]

  • locus tag: SA2089 [new locus tag: SA_RS12000 ]
  • symbol: SarR
  • description: hypothetical protein
  • length: 115
  • theoretical pI: 9.86544
  • theoretical MW: 13668.7
  • GRAVY: -0.623478

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 104.4)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 26.5)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.7)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family (TIGR00921; HMM-score: 11)
  • TheSEED:  
    Transcriptional regulator SarR (Staphylococcal accessory regulator R) 
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 30.5)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 21.3)
    MarR; MarR family (PF01047; HMM-score: 19.1)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.4)
    PLP_aminotran (CL0061) Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 14.6)
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 14.2)
    no clan definedUDG; Uracil DNA glycosylase superfamily (PF03167; HMM-score: 13.2)
    HTH (CL0123) HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 11.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 23
    • Cmax: 0.123
    • Cmax_pos: 58
    • Smax: 0.223
    • Smax_pos: 12
    • Smean: 0.126
    • D: 0.127
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]