From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2141 [new locus tag: SA_RS12295 ]
  • pan locus tag?: SAUPAN005850000
  • symbol: SA2141
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2141 [new locus tag: SA_RS12295 ]
  • symbol: SA2141
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2405733..2406371
  • length: 639
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACAAATCCAAATCAACGATTAGAACCATTTGATGAGACATTTCAACAACCGAATATT
    CATCGTGGTAAGCGATATGGTAAGAAAAAACGTTCATTGGTAAGCATGATTATTCAAATC
    ATTGTTGTTATATTAACCGCAATCGCTGGATACAGCATGTGGAAACAACCCATTTTTAAT
    ATTGTCTTCACCAAAGAATCTGTAGATTTTGATGGCATTAAAAATTTTAACGAGACAATT
    GGAAAAATGCATCAATTAAATATTAATTTGGGTAATATCAATGATTTACAACAAGGAATC
    GATCGCTTAATTTTAGTCTTTAACGGTTTCTTTATTCTATGTATCGTTAGCCTAGTCATA
    ACAATACTGACAATTGTATTTAATCGCACAGTTCTAAAAGTAGTAAATATTTTAGTGTTA
    ACAATTATGTTAGTCATTACTTTGTATTTCAGTTATATTATTAAAACACTCGCACAAGAA
    ATTGCAGATGCTTTAAAAAAATATTATTTAAATGTACCACCAGATCAAGTGATTACAGAA
    GCTGACGCTATTCATAACGGCATCATTTTACTGGGCTGTAGCATCGGTTTACTTGTTATA
    AGCTTATTCTTCCGTAATCGCATGCCTCGTTTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2141 [new locus tag: SA_RS12295 ]
  • symbol: SA2141
  • description: hypothetical protein
  • length: 212
  • theoretical pI: 10.0849
  • theoretical MW: 24225.8
  • GRAVY: 0.452358

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssB (TIGR03926; HMM-score: 12.2)
  • TheSEED:  
    FIG01108339: hypothetical protein 
  • PFAM:
    no clan definedTspO_MBR; TspO/MBR family (PF03073; HMM-score: 18.2)
    EI24; Etoposide-induced protein 2.4 (EI24) (PF07264; HMM-score: 16)
    CopD_like (CL0430) DUF4149; Domain of unknown function (DUF4149) (PF13664; HMM-score: 15.8)
    PH (CL0266) UCH_N; N-terminal of ubiquitin carboxyl-terminal hydrolase 37 (PF16674; HMM-score: 14)
    no clan definedDUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 13.6)
    PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 10.8)
    no clan definedDUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 9.5)
    OppC_N; N-terminal TM domain of oligopeptide transport permease C (PF12911; HMM-score: 8.7)
    TMCCDC2; Transmembrane and coiled-coil domain-containing protein 2 (PF15844; HMM-score: 7.5)
    ATP_synt_H; ATP synthase subunit H (PF05493; HMM-score: 7.2)
    DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 6.8)
    CobD_Cbib; CobD/Cbib protein (PF03186; HMM-score: 5.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.172
    • Ymax_pos: 44
    • Cmax: 0.143
    • Cmax_pos: 61
    • Smax: 0.365
    • Smax_pos: 36
    • Smean: 0.211
    • D: 0.187
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFNIVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVITILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKTLAQEIADALKKYYLNVPPDQVITEADAIHNGIILLGCSIGLLVISLFFRNRMPRLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA2141 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]