From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2171 [new locus tag: SA_RS12465 ]
  • pan locus tag?: SAUPAN005909000
  • symbol: SA2171
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2171 [new locus tag: SA_RS12465 ]
  • symbol: SA2171
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2440199..2440555
  • length: 357
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGAAAAAAGGTTTTGGTCTTGGTATTAGTTTAATCGCCATCATGTTAATTGTA
    TGTATTGTATTAGTAATCATGATGATGACTGGCGGAAAGAAAGATACATACTATGGAATT
    ATGAAAGATAATACTACTATTGAAAAAATGATTAGTGAAAAAGATGAAAGTATTGAAAAA
    AATGTTAAATTACCTTCAGATTCAGATGTTAAAGTTAAAAAAGGTGATTTTGTAATTGTT
    TATAAATTAGCAGATTCAGATAAAATTGTTAAAGTTAAAAAAGTTGACCATGATGACGTC
    CCTCACGGTTTAATGATGAAAATTCATGACATGGGCAAAATGCACATGAAACACTAA
    60
    120
    180
    240
    300
    357

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2171 [new locus tag: SA_RS12465 ]
  • symbol: SA2171
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 9.96512
  • theoretical MW: 13340.1
  • GRAVY: -0.111017

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108504: hypothetical protein 
  • PFAM:
    no clan definedDUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 125.6)
    NusG_II; NusG domain II (PF07009; HMM-score: 14.4)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.9)
    UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 13.3)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.229
    • Ymax_pos: 11
    • Cmax: 0.158
    • Cmax_pos: 35
    • Smax: 0.619
    • Smax_pos: 1
    • Smean: 0.499
    • D: 0.334
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEKNVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]