From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2215 [new locus tag: SA_RS12710 ]
  • pan locus tag?: SAUPAN005967000
  • symbol: bioD
  • pan gene symbol?: bioD
  • synonym:
  • product: dethiobiotin synthetase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2215 [new locus tag: SA_RS12710 ]
  • symbol: bioD
  • product: dethiobiotin synthetase
  • replicon: chromosome
  • strand: -
  • coordinates: 2486019..2486705
  • length: 687
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAGGATTTTTATTACAAGTACGAATACTGATGTAGGCAAAACCTATGTTACAAAGCAT
    TTATACCATGCTTTGAAAACACGTGGTCATCGTGTTTGTGTTTTTAAACCATTTCAAACT
    GAGGAACGCCAAGACGGGACATTTCCAGATTTAGAAGTATTTAAAAATGAATGTGATTTA
    AGCTATGACATAACGTCACTTTATACTTTTAAGCAACCTGTATCACCACACCTTGCATTT
    AAAATGACAGATCAAATTTTTCTAAATAAGCAGCGTGTATTAGATAAGGTAAAAGTTTTA
    GATAAGGAATTTGATTTTATCTTAATTGAGGGTGCTGGGGGAATTGCCGTACCAATATAT
    GAAGGTACAGATGATTTCTACATGACTAAAGATCTAATCAATGATTGTGCAGATTGTGTC
    ATCAGTGTGTTGCCATCAAAATTAGGTGCTATTAGCGATGCCGTTGTTCACCAAGATTAT
    GTTAATAAGAATGTATCGGCGAGTAATTTTTTAATAATGAATCGCTATACAGACAGCTAT
    ATTGAAAAAGACAATCAAATTACGATTGGAAAATTAACAAATAAAACAGTCTATACATTT
    GAAGAACATGCCACGTATGAAAATTTCTCAGAAGCATTTTTAAAACAATTAATAGGAGTT
    AAAAATGAATTACACACAACAACTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2215 [new locus tag: SA_RS12710 ]
  • symbol: BioD
  • description: dethiobiotin synthetase
  • length: 228
  • theoretical pI: 5.89072
  • theoretical MW: 26112.5
  • GRAVY: -0.265351

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotindethiobiotin synthase (TIGR00347; EC 6.3.3.3; HMM-score: 103.2)
    Cellular processesCellular processesCell divisionseptum site-determining protein MinD (TIGR01968; HMM-score: 30.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 20.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.9)
    cell division ATPase MinD (TIGR01969; HMM-score: 13.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 12.1)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsBiotinBiotin biosynthesis Dethiobiotin synthetase (EC 6.3.3.3) 
  • PFAM:
    P-loop_NTPase (CL0023) AAA_26; AAA domain (PF13500; HMM-score: 86.5)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 25.6)
    DUF1611; Domain of unknown function (DUF1611_C) P-loop domain (PF07755; HMM-score: 21.4)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 17.8)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 22
    • Cmax: 0.109
    • Cmax_pos: 44
    • Smax: 0.214
    • Smax_pos: 43
    • Smean: 0.159
    • D: 0.142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15928005 NCBI
  • RefSeq: NP_375538 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRIFITSTNTDVGKTYVTKHLYHALKTRGHRVCVFKPFQTEERQDGTFPDLEVFKNECDLSYDITSLYTFKQPVSPHLAFKMTDQIFLNKQRVLDKVKVLDKEFDFILIEGAGGIAVPIYEGTDDFYMTKDLINDCADCVISVLPSKLGAISDAVVHQDYVNKNVSASNFLIMNRYTDSYIEKDNQITIGKLTNKTVYTFEEHATYENFSEAFLKQLIGVKNELHTTT

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1289 (BirA*)
    BirA* (TF) important in Biotin biosynthesis  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]