From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2227
  • pan locus tag?: SAUPAN005987000
  • symbol: SA2227
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2227
  • symbol: SA2227
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2499033..2499446
  • length: 414
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAGTTTCATCAATTGCATTACTTATAGCAGCCTTGTTAAACTACATTTTCCCTAAT
    GCAATTCAACTATTCATATACGTTACAACGTTATCAACTGTGTTGTTTTTAGTTGTTTGG
    GCAATGATTATTGTCGCTTATCTAATGTATTTGAAAAAGCATCCTGAGGCACATAAAAAC
    AGTAAATTTAAGTTGATTGGTGGTAAGCCTATTGCTTACATTATTCTAGCGTTCTTCTTC
    TTTGTATTCATTTTATTATTCTTTAGTGACGAAACAAGAGCAGCTATTTATATTTCACCA
    TTCTGGTTTATATTTTTATTTTTCTTTTATAAAAAATACAAAACGAATGCTGAAAAGCTC
    GCGTATGAACAACGACAAAATGACAGCGGTCATTTCAGATATGACAATCAATAA
    60
    120
    180
    240
    300
    360
    414

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2227
  • symbol: SA2227
  • description: hypothetical protein
  • length: 137
  • theoretical pI: 9.9069
  • theoretical MW: 16199.2
  • GRAVY: 0.641606

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesGABA permease (TIGR01773; HMM-score: 10.5)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 10.4)
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 10.2)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineGlycine and Serine Utilization D-serine/D-alanine/glycine transporter 
    CarbohydratesCentral carbohydrate metabolismPyruvate Alanine Serine Interconversions D-serine/D-alanine/glycine transporter 
  • PFAM:
    APC (CL0062) AA_permease; Amino acid permease (PF00324; HMM-score: 28.8)
    AA_permease_2; Amino acid permease (PF13520; HMM-score: 18.6)
    no clan definedOxidored_q3; NADH-ubiquinone/plastoquinone oxidoreductase chain 6 (PF00499; HMM-score: 16.8)
    DUF4500; Domain of unknown function (DUF4500) (PF14937; HMM-score: 14.1)
    Pho86; Inorganic phosphate transporter Pho86 (PF11124; HMM-score: 12.8)
    RAMP4; Ribosome associated membrane protein RAMP4 (PF06624; HMM-score: 11.5)
    Transporter (CL0375) Amastin; Amastin surface glycoprotein (PF07344; HMM-score: 11.4)
    no clan definedCobS; Cobalamin-5-phosphate synthase (PF02654; HMM-score: 10.4)
    Gx_transp (CL0315) ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 10)
    Peptidase_MA (CL0126) Peptidase_M50B; Peptidase M50B-like (PF13398; HMM-score: 8.5)
    Peroxisome (CL0484) PRT_C; Plant phosphoribosyltransferase C-terminal (PF08372; HMM-score: 8.5)
    no clan definedDUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 8.3)
    IncA; IncA protein (PF04156; HMM-score: 8.3)
    NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 7.4)
    no clan definedDHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 6.6)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 6.1)
    DUF3043; Protein of unknown function (DUF3043) (PF11241; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 11
    • Cmax: 0.176
    • Cmax_pos: 22
    • Smax: 0.378
    • Smax_pos: 3
    • Smean: 0.307
    • D: 0.228
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

  • GI: 15928017 NCBI
  • RefSeq: NP_375550 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLVSSIALLIAALLNYIFPNAIQLFIYVTTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFFSDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: CcpA, CodY
    CcpA (TF) important in Carbon catabolismRegPrecise
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]