From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2245 [new locus tag: SA_RS12895 ]
  • pan locus tag?: SAUPAN006013000
  • symbol: SA2245
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2245 [new locus tag: SA_RS12895 ]
  • symbol: SA2245
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2522494..2522760
  • length: 267
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAGGAAAATAAAA
    CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
    AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
    ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
    CTATCGGCATGGTCACATTATGATTAA
    60
    120
    180
    240
    267

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2245 [new locus tag: SA_RS12895 ]
  • symbol: SA2245
  • description: hypothetical protein
  • length: 88
  • theoretical pI: 10.1626
  • theoretical MW: 10676.2
  • GRAVY: -0.898864

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistanceaddiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 97.9)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 97.9)
    Cellular processesCellular processesToxin production and resistanceaddiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 19.6)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 19.6)
    Signal transductionRegulatory functionsProtein interactionsHPr(Ser) kinase/phosphatase (TIGR00679; EC 2.7.1.-; HMM-score: 11.2)
    Signal transductionSignal transductionPTSHPr(Ser) kinase/phosphatase (TIGR00679; EC 2.7.1.-; HMM-score: 11.2)
  • TheSEED:  
    mRNA interferase RelE 
  • PFAM:
    Plasmid-antitox (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38)
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 27.3)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.6)
    no clan definedTINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 16.5)
    Plasmid-antitox (CL0136) ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 16.3)
    Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 14.7)
    HHH (CL0198) HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.165
    • Ymax_pos: 15
    • Cmax: 0.104
    • Cmax_pos: 46
    • Smax: 0.302
    • Smax_pos: 5
    • Smean: 0.265
    • D: 0.204
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNYTVKIKNSAKSDLRKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]