From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2266 [new locus tag: SA_RS13010 ]
  • pan locus tag?: SAUPAN006056000
  • symbol: SA2266
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2266 [new locus tag: SA_RS13010 ]
  • symbol: SA2266
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2543070..2543765
  • length: 696
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACAGTATTAACAGATAAAATAGCAGTAGTTACAGGTGCAGGTAGTGGTATTGGAGAA
    GCAATTGCAACATTACTACATGAAGAAGGGGCGAAAGTTGTCTTAGCCGGTAGAAATAAA
    GATAAACTACAAAATGTGGCGAATCAATTAGCTCAAGATAGTGTGAAGGTAGTGCCAACA
    GATGTAACGAATAAAGAAGAAGTCGATGAATTGATGAAAATTGCACAACAAACATTCGGT
    GGTTTGGATATTGTTATCAATAGTGCGGGACAAATGTTATCGTCTAAGATTACTGATTAT
    CAAGTAGATGAGTGGGATAGTATGATTGATGTGAATATCAAAGGCACTTTATATACGGCA
    CAGGCTGCATTACCAACTATGTTAGAACAATCAAGTGGACATCTTATTAACATTGCATCT
    ATTTCTGGCTTTGAAGTAACGAAAAGTAGTACGATTTATAGTGCGACGAAAGCAGCAGTT
    CACACTATTACTCAAGGATTAGAAAAAGAGTTGGCAAAGACAGGCGTTAAAGTAACAAGC
    ATTTCTCCAGGAATGGTAGATACAGCAATAACAGCCGCATATAATCCAAGTGATCGTAAA
    AAGCTTGATCCACAAGATATTGCAGAAGCGGTATTGTATGCATTAACACAACCAAAGCAT
    GTTAACGTGAATGAAATTACAGTGCGTCCTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2266 [new locus tag: SA_RS13010 ]
  • symbol: SA2266
  • description: hypothetical protein
  • length: 231
  • theoretical pI: 4.90009
  • theoretical MW: 24577.8
  • GRAVY: -0.0281385

Function[edit source | edit]

  • reaction:
    EC 1.-.-.-?  ExPASy
  • TIGRFAM:
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 154.2)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 147.2)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 145.5)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 125.2)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 124.2)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 122.6)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 120.2)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 117.6)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 115.1)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 112.3)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 81.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 79.9)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 58.1)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 43.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 33.3)
    Hypothetical proteinsConservedTIGR01777 family protein (TIGR01777; HMM-score: 19.6)
    MetabolismAmino acid biosynthesisAromatic amino acid familyshikimate dehydrogenase (TIGR00507; EC 1.1.1.25; HMM-score: 19.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminglutamyl-tRNA reductase (TIGR01035; EC 1.2.1.70; HMM-score: 18.1)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 17.2)
    Unknown functionEnzymes of unknown specificityputative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 16.1)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein PilL, PFGI-1 class (TIGR03748; HMM-score: 15.8)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS11 (TIGR03632; HMM-score: 11.1)
  • TheSEED:  
    Oxidoreductase, short-chain dehydrogenase/reductase family 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short; short chain dehydrogenase (PF00106; HMM-score: 194.4)
    adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 163.5)
    KR; KR domain (PF08659; HMM-score: 58.4)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 40.3)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 37.5)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 31.9)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 25)
    Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 24.6)
    3HCDH_N; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737; HMM-score: 24.1)
    NmrA; NmrA-like family (PF05368; HMM-score: 21.3)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 19)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 18.4)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 18.4)
    S11_L18p (CL0267) Ribosomal_S11; Ribosomal protein S11 (PF00411; HMM-score: 16.9)
    no clan definedArg_tRNA_synt_N; Arginyl tRNA synthetase N terminal domain (PF03485; HMM-score: 16.9)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 16.5)
    HUP (CL0039) ETF; Electron transfer flavoprotein domain (PF01012; HMM-score: 16.1)
    no clan definedAsp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 15.3)
    NADP_Rossmann (CL0063) TrkA_N; TrkA-N domain (PF02254; HMM-score: 14.7)
    THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 14.2)
    T3SS-hook (CL0424) Flg_hook; Flagellar hook-length control protein FliK (PF02120; HMM-score: 13.7)
    NADP_Rossmann (CL0063) DUF1776; Fungal family of unknown function (DUF1776) (PF08643; HMM-score: 13.5)
    RNase_H (CL0219) DDE_Tnp_1_3; Transposase DDE domain (PF13612; HMM-score: 13.2)
    NADP_Rossmann (CL0063) IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 12.6)
    no clan definedNitro_FeMo-Co; Dinitrogenase iron-molybdenum cofactor (PF02579; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.186
    • Ymax_pos: 24
    • Cmax: 0.149
    • Cmax_pos: 24
    • Smax: 0.308
    • Smax_pos: 16
    • Smean: 0.204
    • D: 0.193
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTVLTDKIAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKDKLQNVANQLAQDSVKVVPTDVTNKEEVDELMKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPSDRKKLDPQDIAEAVLYALTQPKHVNVNEITVRPV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]